This vignette goes through generating your own sequences from a
specified background model, shuffling sequences whilst maintaining a
certain k-let size, and the scanning of sequences and
scoring of motifs. For an introduction to sequence motifs, see the introductory vignette. For a
basic overview of available motif-related functions, see the motif manipulation vignette. For a
discussion on motif comparisons and P-values, see the motif comparisons and P-values
vignette. For a worked example that strings these scanning, discovery,
and enrichment pieces together on a real ChIP-seq dataset, see the ChIP-seq workflow vignette.
The Biostrings package offers an excellent suite of
functions for dealing with biological sequences. The
universalmotif package hopes to help extend these by
providing the create_sequences() and
shuffle_sequences() functions. The first of these,
create_sequences(), generates a set of letters in random
order, then passes these strings to the Biostrings package
to generate the final XStringSet object. The number and
length of sequences can be specified. The probabilities of individual
letters can also be set.
The freqs option of create_sequences() also
takes higher order backgrounds. In these cases the sequences are
constructed in a Markov-style manner, where the probability of each
letter is based on which letters precede it.
library(universalmotif)
library(Biostrings)
## Create some DNA sequences for use with an external program (default
## is DNA):
sequences.dna <- create_sequences(seqnum = 500,
freqs = c(A=0.3, C=0.2, G=0.2, T=0.3))
## writeXStringSet(sequences.dna, "dna.fasta")
sequences.dna
#> DNAStringSet object of length 500:
#> width sequence
#> [1] 100 TAAGAATTATGAGCTATATTGACTGTGAGTAGA...GCGTAGTTTAGGTGAATTACGGTAGGCAGTAC
#> [2] 100 GTGAATGGGACTTACTTCAGTCCGATCGATAGG...TTGCAAATGAACATGAATTACAAGCATTCCAT
#> [3] 100 GCTTGTTTAAGGGTATATAAGGGTAATTTCGAA...ATTCTGATCCTAGGTCAGAGATTTAATTGTTG
#> [4] 100 GAGGGTAGGTTCCGTGCGGTTTTGCCAGTGCTT...GTTTTCCGCTGTCCTTACCTCATCCAGAACGA
#> [5] 100 GTAAGCTTTTAAAGTAAGCACAGGAATAAGCGT...ACAGCATGGTACTGAAATTATGCGACGAGTGA
#> ... ... ...
#> [496] 100 TTAAGCTACATAAGAGTCCAATCGAATATCAGT...TATTTTCTTGACTGAAGTTTTCGGCCCCTGTG
#> [497] 100 CTGTATTTAGGGCTGAATAGCTCCTCCCGGAGT...AATAGTCACGAAATTGATAATACGTACTCCCA
#> [498] 100 GCATGTTCCATTGGTTAGTTTCCCACGGTCAGT...TAAGAACTTATTTTTCTAGACTTTTGGTGTAA
#> [499] 100 CGAATTAAATACAAGGTTATCATCGCCAAGAGG...GAATAGAGCCTCAGATGCCGGAAATTACACTG
#> [500] 100 TGAAAAGAGAGGGGATCATGCGTTAGAAACTTG...TGCGACATACAACAAACAATGGCGGGAAAGAC
## Amino acid:
create_sequences(alphabet = "AA")
#> AAStringSet object of length 100:
#> width sequence
#> [1] 100 RHTTEKCLPKWIHAMHNEEGADTKRSVRTHGQK...PFLSYSTNQCLGEHRRDQTMAVNSAEDWQEPI
#> [2] 100 NPTTQDIAEDEAQIQCVFGWDCFHPKEFIPQSY...GDDEYRAQAKIETNRVCHNIGPALWINFICNI
#> [3] 100 HPVLIAVFEFAMYIVTYLHMTFARYKESDVVPL...GESTKDDNWMCPQIDTGEMNCEQMYLKGTQGN
#> [4] 100 MTAEPQMFKGCKKTMPEHDAYWKYCTFPNQLPW...NCAYKKPMVWAEILNYSWFNVIAAMKGWFLRM
#> [5] 100 LEPYSNYHLQLTIQNMVFNRGTYLQWGMLNTGN...ALSLCYMTFYFMYWGYFTTFVMMASCVDIFFN
#> ... ... ...
#> [96] 100 NNPYVQIASYMMLLHWVDWEASAKYSPNVVFKK...AVHEWDACENQTDVYRWHALYWSMLVAWALGY
#> [97] 100 LNQHHQCMMQYGPRLASKSFTSYNFKMDNCQRI...DTMQKKGYRCGATVIEKWATDWSLDWIRNALD
#> [98] 100 NVLIHACKAKSDVKAAFHNCSWPQLHTYRSKVN...YACQLIARRPLNWWHNTTISTSVPGKDFHFDF
#> [99] 100 AHLELLPNATRKNYKKHDGPQFETSNIDLRKPD...HSIRFLQWWYTLAITIVLKMFPAHNGMVIDHL
#> [100] 100 ANEYIAALMGYHHERPMVDEVAPWSRSFNERDF...CWANILCVQIYFVNMTHKVWRAAQIMRSTEFL
## Any set of characters can be used
create_sequences(alphabet = paste0(letters, collapse = ""))
#> BStringSet object of length 100:
#> width sequence
#> [1] 100 dimhvcagsijgokrxjxokcdlmmvlwtixxm...mounrhsagumujafmwsbpbridqywbgddd
#> [2] 100 rwogrimtwkscanzaacojakjrgcurxanjg...wijwxygolwhyzzmttfbutcsxqitxptdt
#> [3] 100 blxblxbrkpkpimtyncownfawkkdzsqtgb...bjqliiqtkjxojfmhmbmlzmrghxqpggqa
#> [4] 100 thgykewqhwxxdrkizsmyxpafnmiuanwyz...rjxolgpkmceapoyxtulvqqlvzowgjzsc
#> [5] 100 jfgbgzqhwbcwfttukrixkvcrmkcxzoyzg...hxifxaniabysmltprdqskaocdkkrcyfy
#> ... ... ...
#> [96] 100 ywmpzbbmaxihsvjfwpgwyjommjvsyuacu...nsommficxgdpoakowiswdinksqyqcqvv
#> [97] 100 vvosrpomqzjoqtreasiffxhqcvmictnsu...qxesuofrgndsjpmofrpmgarhrhlczezn
#> [98] 100 ljbopkxqougjolwfwrbergsrzufmubkyj...jcihheuusflhzsolwmzhxdquxanxmwdf
#> [99] 100 mymgxjwypvwriynojbeyhulsghxojfpkp...nxjaodjavzvgogswxlfsgnumkdrbypkt
#> [100] 100 rgqawjgdotvtuqoielwilyvlsrnukquom...otsyxpjeprarpfkfcoreiaozdfhhftpxSequence backgrounds can be retrieved for DNA and RNA sequences with
oligonucleotideFrequency() from Biostrings.
Unfortunately, no such Biostrings function exists for other
sequence alphabets. The universalmotif package provides
get_bkg() to remedy this. Similarly, the
get_bkg() function can calculate higher order backgrounds
for any alphabet as well. It is recommended to use
oligonucleotideFrequency() for very long (e.g. billions of
characters) DNA and RNA sequences whenever possible though, as it is
much faster than get_bkg().
library(universalmotif)
## Background of DNA sequences:
dna <- create_sequences()
get_bkg(dna, k = 1:2)
#> DataFrame with 20 rows and 3 columns
#> klet count probability
#> <character> <numeric> <numeric>
#> 1 A 2564 0.2564000
#> 2 C 2479 0.2479000
#> 3 G 2448 0.2448000
#> 4 T 2509 0.2509000
#> 5 AA 627 0.0633333
#> ... ... ... ...
#> 16 GT 595 0.0601010
#> 17 TA 643 0.0649495
#> 18 TC 650 0.0656566
#> 19 TG 613 0.0619192
#> 20 TT 587 0.0592929
## Background of non DNA/RNA sequences:
qwerty <- create_sequences("QWERTY")
get_bkg(qwerty, k = 1:2)
#> DataFrame with 42 rows and 3 columns
#> klet count probability
#> <character> <numeric> <numeric>
#> 1 E 1651 0.1651
#> 2 Q 1661 0.1661
#> 3 R 1665 0.1665
#> 4 T 1645 0.1645
#> 5 W 1718 0.1718
#> ... ... ... ...
#> 38 YQ 258 0.0260606
#> 39 YR 280 0.0282828
#> 40 YT 269 0.0271717
#> 41 YW 292 0.0294949
#> 42 YY 254 0.0256566One way to compare sequences is by k-let composition. The following
example illustrates how one could go about doing this using only the
universalmotif package and base graphics.
library(universalmotif)
## Generate three random sets of sequences:
s1 <- create_sequences(seqnum = 20,
freqs = c(A = 0.3, C = 0.2, G = 0.2, T = 0.3))
s2 <- create_sequences(seqnum = 20,
freqs = c(A = 0.4, C = 0.4, G = 0.1, T = 0.1))
s3 <- create_sequences(seqnum = 20,
freqs = c(A = 0.2, C = 0.3, G = 0.3, T = 0.2))
## Create a function to get properly formatted k-let counts:
get_klet_matrix <- function(seqs, k, groupName) {
bkg <- get_bkg(seqs, k = k, merge.res = FALSE)
bkg <- bkg[, c("sequence", "klet", "count")]
bkg <- reshape(bkg, idvar = "sequence", timevar = "klet",
direction = "wide")
suppressWarnings(as.data.frame(cbind(Group = groupName, bkg)))
}
## Calculate k-let content (up to you what size k you want!):
s1 <- get_klet_matrix(s1, 4, 1)
s2 <- get_klet_matrix(s2, 4, 2)
s3 <- get_klet_matrix(s3, 4, 3)
# Combine everything into a single object:
sAll <- rbind(s1, s2, s3)
## Do the PCA:
sPCA <- prcomp(sAll[, -(1:2)])
## Plot the PCA:
plot(sPCA$x, col = c("red", "forestgreen", "blue")[sAll$Group], pch = 19)This example could be improved by using
tidyr::pivot_wider() instead of reshape() (the
former is much faster), and plotting the PCA using the
ggfortify package to create a nicer ggplot2
plot. Feel free to play around with different ways of plotting the data!
Additionally, you could even try using t-SNE instead of PCA (such as via
the Rtsne package).
When performing de novo motif searches or motif enrichment analyses, it is common to do so against a set of background sequences. In order to properly identify consistent patterns or motifs in the target sequences, it is important that there be maintained a certain level of sequence composition between the target and background sequences. This reduces results which are derived purely from base differential letter frequency biases.
In order to avoid these results, typically it is desirable to use a
set of background sequences which preserve a certain k-let
size (such as dinucleotide or trinucleotide frequencies in the case of
DNA sequences). Though for some cases a set of similar sequences may
already be available for use as background sequences, usually background
sequences are obtained by shuffling the target sequences, while
preserving a desired k-let size. For this purpose, a
commonly used tool is uShuffle (Jiang et al. 2008). The
universalmotif package aims to provide its own
k-let shuffling capabilities for use within R
via shuffle_sequences().
The universalmotif package offers three different
methods for sequence shuffling: euler, markov
and linear. The first method, euler, can
shuffle sequences while preserving any desired k-let size.
Furthermore, 1-letter counts will always be maintained. However, due to
the nature of the method, the first and last letters will remain
unshuffled. This method is based on the initial random Eulerian walk
algorithm proposed by Altschul and Erickson
(1985) and the subsequent cycle-popping algorithm detailed by
Propp and Wilson (1998) for quickly and
efficiently finding Eulerian walks.
The second method, markov, can only guarantee that the
approximate k-let frequency will be maintained, but not
that the original letter counts will be preserved. The
markov method involves determining the original
k-let frequencies, then creating a new set of sequences
which will have approximately similar k-let frequency. As a
result the counts for the individual letters will likely be different.
Essentially, it involves a combination of determining k-let
frequencies followed by create_sequences(). This type of
pseudo-shuffling is discussed by Fitch
(1983).
The third method, linear, preserves the original
1-letter counts exactly, but uses a more crude shuffling technique. In
this case the sequence is split into sub-sequences every
k-let (of any size), which are then re-assembled randomly.
This means that while shuffling the same sequence multiple times with
method = "linear" will result in different sequences, they
will all have started from the same set of k-length
sub-sequences (just re-assembled differently).
library(universalmotif)
library(Biostrings)
data(ArabidopsisPromoters)
## Potentially starting off with some external sequences:
# ArabidopsisPromoters <- readDNAStringSet("ArabidopsisPromoters.fasta")
euler <- shuffle_sequences(ArabidopsisPromoters, k = 2, method = "euler")
markov <- shuffle_sequences(ArabidopsisPromoters, k = 2, method = "markov")
linear <- shuffle_sequences(ArabidopsisPromoters, k = 2, method = "linear")
k1 <- shuffle_sequences(ArabidopsisPromoters, k = 1)Let us compare how the methods perform:
o.letter <- get_bkg(ArabidopsisPromoters, 1)
e.letter <- get_bkg(euler, 1)
m.letter <- get_bkg(markov, 1)
l.letter <- get_bkg(linear, 1)
data.frame(original=o.letter$count, euler=e.letter$count,
markov=m.letter$count, linear=l.letter$count, row.names = DNA_BASES)
#> original euler markov linear
#> A 17384 17384 17386 17384
#> C 8081 8081 8194 8081
#> G 7583 7583 7570 7583
#> T 16952 16952 16850 16952
o.counts <- get_bkg(ArabidopsisPromoters, 2)
e.counts <- get_bkg(euler, 2)
m.counts <- get_bkg(markov, 2)
l.counts <- get_bkg(linear, 2)
data.frame(original=o.counts$count, euler=e.counts$count,
markov=m.counts$count, linear=l.counts$count,
row.names = get_klets(DNA_BASES, 2))
#> original euler markov linear
#> AA 6893 6893 6140 6418
#> AC 2614 2614 2798 2717
#> AG 2592 2592 2572 2616
#> AT 5276 5276 5856 5613
#> CA 3014 3014 2787 2914
#> CC 1376 1376 1385 1337
#> CG 1051 1051 1281 1143
#> CT 2621 2621 2729 2678
#> GA 2734 2734 2577 2713
#> GC 1104 1104 1257 1167
#> GG 1176 1176 1181 1202
#> GT 2561 2561 2551 2496
#> TA 4725 4725 5861 5327
#> TC 2977 2977 2748 2855
#> TG 2759 2759 2532 2610
#> TT 6477 6477 5695 6144If you have a fairly heterogeneous sequence and wish to preserve the
presence of local “patches” of differential sequence composition, you
can set window = TRUE in the
shuffle_sequences() function. In the following example, the
sequence of interest has an AT rich first half followed by a second half
with an even background. The impact on this specific sequence
composition is observed after regular and local shuffling, using the
per-window functionality of get_bkg() (via
window = TRUE). Fine-tune the window size and overlap
between windows with window.size and
window.overlap.
library(Biostrings)
library(universalmotif)
library(ggplot2)
myseq <- DNAStringSet(paste0(
create_sequences(seqlen = 500, freqs = c(A=0.4, T=0.4, C=0.1, G=0.1)),
create_sequences(seqlen = 500)
))
myseq_shuf <- shuffle_sequences(myseq)
myseq_shuf_local <- shuffle_sequences(myseq, window = TRUE)
myseq_bkg <- get_bkg(myseq, k = 1, window = TRUE)
myseq_shuf_bkg <- get_bkg(myseq_shuf, k = 1, window = TRUE)
myseq_shuf_local_bkg <- get_bkg(myseq_shuf_local, k = 1, window = TRUE)
myseq_bkg$group <- "original"
myseq_shuf_bkg$group <- "shuffled"
myseq_shuf_local_bkg$group <- "shuffled-local"
myseq_all <- suppressWarnings(as.data.frame(
rbind(myseq_bkg, myseq_shuf_bkg, myseq_shuf_local_bkg)
))
ggplot(myseq_all, aes(x = start, y = probability, colour = klet)) +
geom_line() +
theme_minimal() +
scale_colour_manual(values = universalmotif:::DNA_COLOURS) +
xlab(element_blank()) +
facet_wrap(~group, ncol = 1)
#> Warning: `label` cannot be a <ggplot2::element_blank> object.match_bkg()shuffle_sequences() randomises each input sequence in
place, preserving that sequence’s own k-let composition. This is
appropriate enough when the input set is roughly homogeneous, but it
does leave a confounder behind: if the input sequences carry a
systematic composition bias relative to the genome (GC-rich ChIP-seq
peaks, AT-rich promoters, and so on), then shuffling alone will not
control for it. match_bkg() takes a different tack,
sampling real sequences from a larger universe so that they match the
input on GC fraction and length (the binned approach that HOMER
uses).
library(universalmotif)
library(Biostrings)
data(ArabidopsisPromoters)
## Pretend the first 10 promoters are "target" and the next 40 are the
## universe; in real usage `universe` would be extracted from a
## BSgenome over a larger pool of genomic regions.
target <- ArabidopsisPromoters[1:10]
universe <- ArabidopsisPromoters[11:50]
set.seed(1)
bkg <- match_bkg(target, universe, n.per.target = 2)
length(bkg) # 20 = 10 targets x 2 matches each
#> [1] 20The result is an XStringSet you can pass directly to
other functions:
Use plot_match_bkg() to visually verify the match
landed:
This simply overlays the GC-fraction and length density curves for the target and the matched background, in a two-panel ggplot.
match_bkg() complements shuffle_sequences()
rather than replacing it (and the same is true the other way around). A
shuffle is what you want when you are after a per-sequence,
k-let-preserving null, whereas a matched background is the better choice
when you need to control for composition bias relative to some genomic
universe. For reproducibility, do remember to call
set.seed() before match_bkg().
implant_motifs()When you are benchmarking a discovery, scanning, or enrichment
pipeline, you need positive sequences that carry known motif instances
at known positions, so that recall and precision can be scored against
an answer key. implant_motifs() is there to produce exactly
those: it takes a set of motifs together with some host sequences,
samples each instance column-by-column from the motif’s PPM, and then
overwrites the bases at the chosen position. Three insertion modes are
available (a fixed n.per.seq count, a Poisson
rate per base pair, or an explicit list of
positions), and a few optional knobs
(centre.bias, min.spacing,
strand) let you mimic ChIP-seq-style central enrichment or
enforce non-overlapping placement.
library(universalmotif)
data(ArabidopsisMotif)
hosts <- create_sequences("DNA", seqnum = 100, seqlen = 500)
## Plant one instance per sequence and get both the sequences and the
## ground-truth positions in a single call. Use set.seed() for
## reproducibility.
set.seed(1)
res <- implant_motifs(ArabidopsisMotif, hosts, n.per.seq = 1,
return.indices = TRUE)
out <- res$sequences
truth <- res$indices
head(truth)
## Quantify recovery
hits <- scan_sequences(ArabidopsisMotif, out, threshold = 0.85,
threshold.type = "logodds")
## Visualise positional density (qvalue = 1 keeps the motif even when,
## as here, the implants are placed uniformly)
peaks <- motif_peaks(as.data.frame(hits), seq.length = 500, qvalue = 1)
plot_motif_peaks(peaks)With return.indices = FALSE (the default) you get back
only the modified XStringSet. With
return.indices = TRUE you instead get a list of two
elements: sequences (the modified XStringSet)
and indices (a data.frame with columns
sequence.i, motif.i, start,
width, strand, and planted).
motif_coocc()enrich_motifs() and enrich_motifs_lite()
test whether each motif is enriched on its own. Transcription factors,
though, often bind as heterodimers, or cooperate at composite
cis-regulatory modules, so a natural next question is whether any pair
of motifs co-occurs in the same sequences more often than chance would
predict. This is what motif_coocc() is for. For every pair
of input motifs it builds the 2x2 contingency table of per-sequence
presence and absence, runs a one-sided Fisher’s exact test, and then
applies a BH correction across all of the tested pairs.
library(universalmotif)
data(ArabidopsisMotif)
m_other <- create_motif("CACGTGCACGTG", name = "Ebox12")
seqs <- create_sequences("DNA", seqnum = 200, seqlen = 500)
## (In real use, hand the function your peaks or promoters here.)
co <- motif_coocc(list(ArabidopsisMotif, m_other), seqs, pvalue = 1e-3)
coThere are two input paths. The default one (shown above) scans
internally via scan_sequences_lite(), and so is DNA/RNA
only. Alternatively, you can hand the function a precomputed hit
table:
hits <- scan_sequences_lite(motifs, seqs, pvalue = 1e-3)
co <- motif_coocc(motifs, hits = hits, n.sequences = length(seqs))The hit-table path accepts any alphabet (amino acid, or custom),
since once a hit table exists the co-occurrence is really just set
arithmetic on the (motif.i, sequence.i) integers.
Setting max.distance = N additionally reports two
descriptive columns: both.clustered (the subset of
co-occurring sequences that have an (A, B) hit pair within
N bp of each other) and median.distance (the
median nearest-pair spacing across those sequences). The Fisher p-value
itself is unchanged by this, since it always tests the same thing (“do A
and B occur in the same sequences more often than chance?”) on the
unfiltered 2x2 table. The two spatial columns are best thought of as
interpretive aids for flagging heterodimer-like arrangements, rather
than as a separate statistical test in their own right.
There are many motif-programs available with sequence scanning
capabilities, such as HOMER and tools from
the MEME suite. The
universalmotif package does not aim to supplant these, but
rather provide convenience functions for quickly scanning a few
sequences without needing to leave the R environment.
Furthermore, these functions allow for taking advantage of the
higher-order (multifreq) motif format described here.
Two scanning-related functions are provided:
scan_sequences() / scan_sequences_lite() and
enrich_motifs() / enrich_motifs_lite(). The
latter simply runs scan_sequences() /
scan_sequences_lite() twice on a set of target and
background sequences. Given a motif of length n,
scan_sequences() / scan_sequences_lite()
considers every possible n-length subsequence in a sequence
and scores it using the PWM format. If the match surpasses the minimum
threshold, it is reported. This is the case regardless of whether one is
scanning with a regular motif, or using the higher-order
(multifreq) motif format (the multifreq matrix
is converted to a PWM) with the older scan_sequences().
Before scanning a set of sequences, one must first decide the minimum
logodds threshold for retrieving matches. This decision is not always
the same between scanning programs out in the wild, nor is it usually
made clear what the cutoff is or how it is decided. As a result,
universalmotif aims to be as transparent as possible in
this regard by allowing for complete control of the threshold. For more
details on PWMs, see the introductory vignette.
One way is to set a cutoff between 0 and 1, then multiply it by the
highest possible PWM score to get a threshold. The
matchPWM() function from the Biostrings
package for example uses a default of 0.8 (shown as "80%").
This is quite arbitrary of course, and every motif will end up with a
different threshold. For high information content motifs, there is
really no right or wrong threshold, as they tend to have fewer
non-specific positions. This means that incorrect letters in a match
will be more punishing. To illustrate this, contrast the following
PWMs:
library(universalmotif)
m1 <- create_motif("TATATATATA", nsites = 50, type = "PWM", pseudocount = 1)
m2 <- matrix(c(0.10,0.27,0.23,0.19,0.29,0.28,0.51,0.12,0.34,0.26,
0.36,0.29,0.51,0.38,0.23,0.16,0.17,0.21,0.23,0.36,
0.45,0.05,0.02,0.13,0.27,0.38,0.26,0.38,0.12,0.31,
0.09,0.40,0.24,0.30,0.21,0.19,0.05,0.30,0.31,0.08),
byrow = TRUE, nrow = 4)
m2 <- create_motif(m2, alphabet = "DNA", type = "PWM")
m1["motif"]
#> T A T A T A T
#> A -5.672425 1.978626 -5.672425 1.978626 -5.672425 1.978626 -5.672425
#> C -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425
#> G -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425
#> T 1.978626 -5.672425 1.978626 -5.672425 1.978626 -5.672425 1.978626
#> A T A
#> A 1.978626 -5.672425 1.978626
#> C -5.672425 -5.672425 -5.672425
#> G -5.672425 -5.672425 -5.672425
#> T -5.672425 1.978626 -5.672425
m2["motif"]
#> S H C N N N
#> A -1.3219281 0.09667602 -0.12029423 -0.3959287 0.2141248 0.1491434
#> C 0.5260688 0.19976951 1.02856915 0.6040713 -0.1202942 -0.6582115
#> G 0.8479969 -2.33628339 -3.64385619 -0.9434165 0.1110313 0.5897160
#> T -1.4739312 0.66371661 -0.05889369 0.2630344 -0.2515388 -0.4102840
#> R N N V
#> A 1.0430687 -1.0732490 0.4436067 0.04222824
#> C -0.5418938 -0.2658941 -0.1202942 0.51171352
#> G 0.0710831 0.5897160 -1.0588937 0.29598483
#> T -2.3074285 0.2486791 0.3103401 -1.65821148In the first example, sequences which do not have a matching base in every position are punished heavily. The maximum logodds score in this case is approximately 20, and for each incorrect position the score is reduced approximately by 5.7. This means that a threshold of zero would allow for at most three mismatches. At this point, it is up to you how many mismatches you would deem appropriate.
This thinking becomes impossible for the second example. In this
case, mismatches are much less punishing, to the point that one could
ask: what even constitutes a mismatch? The answer to this question is
usually much more difficult in such cases. An alternative to manually
deciding upon a threshold is to instead start with the maximum P-value
one would consider appropriate for a match. If, say, we want matches
with a P-value of at most 0.001, then we can use
motif_pvalue() to calculate the appropriate threshold (see
the comparisons and P-values
vignette for details on motif P-values).
This P-value can be further refined to correct for multiple testing
(and becomes a Q-value). There are three available corrections that can
be set in scan_sequences(): Bonferroni (“bonferroni”),
Benjamini & Hochberg (“BH”), and the false discovery rate (“fdr”)
based on the empirical null distribution of motif hits in a set of
sequences. They are excellently explained in Noble (2009), and these explanations will be
briefly regurgitated here.
To begin to understand how these different corrections are implemented, consider the following motif, sequences, example P-value for an example motif hit, and the theoretical maximum number of motif hits:
library(universalmotif)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)
(Example.Score <- score_match(ArabidopsisMotif, "TTCTCTTTTTTTTTT"))
#> [1] 16.81
(Example.Pvalue <- motif_pvalue(ArabidopsisMotif, Example.Score))
#> [1] 6.612819e-07
(Max.Possible.Hits <- sum(width(ArabidopsisPromoters) - ncol(ArabidopsisMotif) + 1))
#> [1] 49300The first correction method, Bonferroni, is by far the simplest. To calculate it, take the P-value of a motif hit and multiply it by the theoretical maximum number of hits:
As you can imagine, the level of punishment the P-value receives corresponds to the size of the sequences you are scanning. If you are scanning an entire genome, then you can expect this to be very punishing and only return near-perfect matches (or no matches). However, for smaller sets of sequences, this correction can be more appropriate.
Next, Benjamini & Hochberg. To perform this correction, the
P-value is divided by its fractional rank in the list of P-values for
all theoretically possible hits sorted in ascending order (this assumes
that P-values are independent and uniformly distributed on [0, 1] under
the null hypothesis). It is important to note that this means the
correction cannot be calculated before the sequences have been scanned
for the motif, and P-values have been calculated for all returned hits.
When requesting this type of Q-value for the minimum threshold of score,
scan_sequences() instead calculates the threshold from the
input Q-value as a P-value, then filters the final results after
Q-values have been calculated. Returning to our example:
(Scan.Results <- scan_sequences(ArabidopsisMotif, ArabidopsisPromoters,
threshold = 0.8, threshold.type = "logodds", calc.qvals = FALSE))
#> DataFrame with 20 rows and 14 columns
#> motif motif.i sequence sequence.i start stop
#> <character> <integer> <character> <integer> <integer> <integer>
#> 1 YTTTYTTTTTYTTTY 1 AT1G05670 47 68 82
#> 2 YTTTYTTTTTYTTTY 1 AT1G19510 45 402 416
#> 3 YTTTYTTTTTYTTTY 1 AT1G49840 27 899 913
#> 4 YTTTYTTTTTYTTTY 1 AT2G22500 14 946 960
#> 5 YTTTYTTTTTYTTTY 1 AT2G22500 14 948 962
#> ... ... ... ... ... ... ...
#> 16 YTTTYTTTTTYTTTY 1 AT3G23170 34 603 617
#> 17 YTTTYTTTTTYTTTY 1 AT4G19520 3 792 806
#> 18 YTTTYTTTTTYTTTY 1 AT4G19520 3 793 807
#> 19 YTTTYTTTTTYTTTY 1 AT4G27652 20 879 893
#> 20 YTTTYTTTTTYTTTY 1 AT4G27652 20 881 895
#> score match thresh.score min.score max.score score.pct
#> <numeric> <character> <numeric> <numeric> <numeric> <numeric>
#> 1 15.407 GTTTCTTTTTTCTTT 15.0272 -125.07 18.784 82.0219
#> 2 17.405 TTTTCTTTTTCTTTT 15.0272 -125.07 18.784 92.6586
#> 3 15.177 CTTTTTGTTTTTTTC 15.0272 -125.07 18.784 80.7975
#> 4 15.827 TCCTCTCTTTCTCTC 15.0272 -125.07 18.784 84.2579
#> 5 15.908 CTCTCTTTCTCTCTT 15.0272 -125.07 18.784 84.6891
#> ... ... ... ... ... ... ...
#> 16 15.734 GTTTCTTCTTTTTTT 15.0272 -125.07 18.784 83.7628
#> 17 15.352 TTTTTTTTTTTTTTT 15.0272 -125.07 18.784 81.7291
#> 18 15.352 TTTTTTTTTTTTTTT 15.0272 -125.07 18.784 81.7291
#> 19 16.410 TTTTCTCTTTTTTTT 15.0272 -125.07 18.784 87.3616
#> 20 16.810 TTCTCTTTTTTTTTT 15.0272 -125.07 18.784 89.4911
#> strand pvalue
#> <character> <numeric>
#> 1 + 3.95595e-06
#> 2 + 2.44369e-07
#> 3 + 5.01977e-06
#> 4 + 2.53853e-06
#> 5 + 2.39165e-06
#> ... ... ...
#> 16 + 2.83419e-06
#> 17 + 4.33848e-06
#> 18 + 4.33848e-06
#> 19 + 1.23950e-06
#> 20 + 6.61282e-07First we sort and calculate the fractional ranks of our P-values, and then divide the P-values:
Pvalues <- Scan.Results$pvalue
Pvalues.Ranks <- rank(Pvalues) / Max.Possible.Hits
Qvalues.BH <- Pvalues / Pvalues.Ranks
(Example.BH <- Qvalues.BH[Scan.Results$match == "TTCTCTTTTTTTTTT"][1])
#> [1] 0.00652024Finally, calculating the false discovery rate from the empirical
distribution of scores. This method requires some additional steps, as
we must obtain the observed and null distributions of hits in our
sequences. Then for each hit, divide the number of hits with a score
equal to or greater in the null distribution by the number of hits with
a score equal to or greater in the observed distribution. Along the way
we must be wary of the nonmonotonicity of the final Q-values (meaning
that as scores get smaller the Q-value does not always increase), and
thus always select the minimum available Q-value as the score increases.
To get the null distribution of hits, we can simply use the P-values
associated with each score as these are analytically calculated from the
null based on the background probabilities (see
?motif_pvalue).
Scan.Results <- Scan.Results[order(Scan.Results$score, decreasing = TRUE), ]
Observed.Hits <- 1:nrow(Scan.Results)
Null.Hits <- Max.Possible.Hits * Scan.Results$pvalue
Qvalues.fdr <- Null.Hits / Observed.Hits
Qvalues.fdr <- rev(cummin(rev(Qvalues.fdr)))
(Example.fdr <- Qvalues.fdr[Scan.Results$match == "TTCTCTTTTTTTTTT"][1])
#> [1] 0.00652024Similarly to Benjamini & Hochberg, these can only be known after scanning has occurred.
To summarize, we can compare the initial P-value with the different corrections:
knitr::kable(
data.frame(
What = c("Score", "P-value", "bonferroni", "BH", "fdr"),
Value = format(
c(Example.Score, Example.Pvalue, Example.bonferroni, Example.BH, Example.fdr),
scientific = FALSE
)
),
format = "markdown", caption = "Comparing P-value correction methods"
)| What | Value |
|---|---|
| Score | 16.8100000000000 |
| P-value | 0.0000006612819 |
| bonferroni | 0.0326011986749 |
| BH | 0.0065202397350 |
| fdr | 0.0065202397350 |
Use your best judgement as to which method is most appropriate for your specific use case.
Furthermore, the scan_sequences() function offers the
ability to scan using the multifreq slot, if available.
This allows one to take into account inter-positional dependencies, and
get matches which more faithfully represent the original sequences from
which the motif originated.
library(universalmotif)
library(Biostrings)
data(ArabidopsisPromoters)
## A 2-letter example:
motif.k2 <- create_motif("CWWWWCC", nsites = 6)
sequences.k2 <- DNAStringSet(rep(c("CAAAACC", "CTTTTCC"), 3))
motif.k2 <- add_multifreq(motif.k2, sequences.k2)Regular scanning:
scan_sequences(motif.k2, ArabidopsisPromoters, RC = TRUE,
threshold = 0.9, threshold.type = "logodds")
#> DataFrame with 94 rows and 15 columns
#> motif motif.i sequence sequence.i start stop score
#> <character> <integer> <character> <integer> <integer> <integer> <numeric>
#> 1 motif 1 AT1G03850 4 203 209 9.08
#> 2 motif 1 AT1G03850 4 334 328 9.08
#> 3 motif 1 AT1G03850 4 713 707 9.08
#> 4 motif 1 AT1G05670 47 706 700 9.08
#> 5 motif 1 AT1G06160 48 498 492 9.08
#> ... ... ... ... ... ... ... ...
#> 90 motif 1 AT5G22690 46 81 87 9.08
#> 91 motif 1 AT5G22690 46 362 368 9.08
#> 92 motif 1 AT5G24660 49 146 140 9.08
#> 93 motif 1 AT5G58430 16 332 338 9.08
#> 94 motif 1 AT5G58430 16 343 349 9.08
#> match thresh.score min.score max.score score.pct strand
#> <character> <numeric> <numeric> <numeric> <numeric> <character>
#> 1 CTAATCC 8.172 -19.649 9.08 100 +
#> 2 CTTTTCC 8.172 -19.649 9.08 100 -
#> 3 CTTAACC 8.172 -19.649 9.08 100 -
#> 4 CTTTACC 8.172 -19.649 9.08 100 -
#> 5 CTAAACC 8.172 -19.649 9.08 100 -
#> ... ... ... ... ... ... ...
#> 90 CAATACC 8.172 -19.649 9.08 100 +
#> 91 CAAATCC 8.172 -19.649 9.08 100 +
#> 92 CATTACC 8.172 -19.649 9.08 100 -
#> 93 CATAACC 8.172 -19.649 9.08 100 +
#> 94 CAAATCC 8.172 -19.649 9.08 100 +
#> pvalue qvalue
#> <numeric> <numeric>
#> 1 0.000976562 1
#> 2 0.000976562 1
#> 3 0.000976562 1
#> 4 0.000976562 1
#> 5 0.000976562 1
#> ... ... ...
#> 90 0.000976562 1
#> 91 0.000976562 1
#> 92 0.000976562 1
#> 93 0.000976562 1
#> 94 0.000976562 1Using 2-letter information to scan:
scan_sequences(motif.k2, ArabidopsisPromoters, use.freq = 2, RC = TRUE,
threshold = 0.9, threshold.type = "logodds")
#> DataFrame with 8 rows and 15 columns
#> motif motif.i sequence sequence.i start stop score
#> <character> <integer> <character> <integer> <integer> <integer> <numeric>
#> 1 motif 1 AT1G19510 45 960 966 17.827
#> 2 motif 1 AT1G49840 27 959 965 17.827
#> 3 motif 1 AT1G77210 32 184 190 17.827
#> 4 motif 1 AT1G77210 32 954 960 17.827
#> 5 motif 1 AT2G37950 15 751 757 17.827
#> 6 motif 1 AT3G57640 33 917 923 17.827
#> 7 motif 1 AT4G12690 12 938 944 17.827
#> 8 motif 1 AT4G14365 35 977 983 17.827
#> match thresh.score min.score max.score score.pct strand
#> <character> <numeric> <numeric> <numeric> <numeric> <character>
#> 1 CTTTTCC 16.0443 -16.842 17.827 100 +
#> 2 CTTTTCC 16.0443 -16.842 17.827 100 +
#> 3 CAAAACC 16.0443 -16.842 17.827 100 +
#> 4 CAAAACC 16.0443 -16.842 17.827 100 +
#> 5 CAAAACC 16.0443 -16.842 17.827 100 +
#> 6 CTTTTCC 16.0443 -16.842 17.827 100 +
#> 7 CAAAACC 16.0443 -16.842 17.827 100 +
#> 8 CTTTTCC 16.0443 -16.842 17.827 100 +
#> pvalue qvalue
#> <numeric> <numeric>
#> 1 1.90735e-06 0.0236988
#> 2 1.90735e-06 0.0236988
#> 3 1.90735e-06 0.0236988
#> 4 1.90735e-06 0.0236988
#> 5 1.90735e-06 0.0236988
#> 6 1.90735e-06 0.0236988
#> 7 1.90735e-06 0.0236988
#> 8 1.90735e-06 0.0236988Furthermore, sequence scanning can be further refined to avoid overlapping hits. Consider:
motif <- create_motif("AAAAAA")
## Leave in overlapping hits:
scan_sequences(motif, ArabidopsisPromoters, RC = TRUE, threshold = 0.9,
threshold.type = "logodds")
#> DataFrame with 491 rows and 15 columns
#> motif motif.i sequence sequence.i start stop score
#> <character> <integer> <character> <integer> <integer> <integer> <numeric>
#> 1 motif 1 AT1G03850 4 56 51 11.934
#> 2 motif 1 AT1G03850 4 57 52 11.934
#> 3 motif 1 AT1G03850 4 58 53 11.934
#> 4 motif 1 AT1G03850 4 59 54 11.934
#> 5 motif 1 AT1G03850 4 243 248 11.934
#> ... ... ... ... ... ... ... ...
#> 487 motif 1 AT5G64310 22 589 594 11.934
#> 488 motif 1 AT5G64310 22 590 595 11.934
#> 489 motif 1 AT5G64310 22 591 596 11.934
#> 490 motif 1 AT5G64310 22 592 597 11.934
#> 491 motif 1 AT5G64310 22 696 701 11.934
#> match thresh.score min.score max.score score.pct strand
#> <character> <numeric> <numeric> <numeric> <numeric> <character>
#> 1 AAAAAA 10.7406 -39.948 11.934 100 -
#> 2 AAAAAA 10.7406 -39.948 11.934 100 -
#> 3 AAAAAA 10.7406 -39.948 11.934 100 -
#> 4 AAAAAA 10.7406 -39.948 11.934 100 -
#> 5 AAAAAA 10.7406 -39.948 11.934 100 +
#> ... ... ... ... ... ... ...
#> 487 AAAAAA 10.7406 -39.948 11.934 100 +
#> 488 AAAAAA 10.7406 -39.948 11.934 100 +
#> 489 AAAAAA 10.7406 -39.948 11.934 100 +
#> 490 AAAAAA 10.7406 -39.948 11.934 100 +
#> 491 AAAAAA 10.7406 -39.948 11.934 100 +
#> pvalue qvalue
#> <numeric> <numeric>
#> 1 0.000244141 0.0494745
#> 2 0.000244141 0.0494745
#> 3 0.000244141 0.0494745
#> 4 0.000244141 0.0494745
#> 5 0.000244141 0.0494745
#> ... ... ...
#> 487 0.000244141 0.0494745
#> 488 0.000244141 0.0494745
#> 489 0.000244141 0.0494745
#> 490 0.000244141 0.0494745
#> 491 0.000244141 0.0494745
## Only keep the highest scoring hit amongst overlapping hits:
scan_sequences(motif, ArabidopsisPromoters, RC = TRUE, threshold = 0.9,
threshold.type = "logodds", no.overlaps = TRUE)
#> DataFrame with 220 rows and 15 columns
#> motif motif.i sequence sequence.i start stop score
#> <character> <integer> <character> <integer> <integer> <integer> <numeric>
#> 1 motif 1 AT1G03850 4 56 51 11.934
#> 2 motif 1 AT1G03850 4 243 248 11.934
#> 3 motif 1 AT1G03850 4 735 740 11.934
#> 4 motif 1 AT1G05670 47 32 27 11.934
#> 5 motif 1 AT1G05670 47 78 73 11.934
#> ... ... ... ... ... ... ... ...
#> 216 motif 1 AT5G64310 22 251 246 11.934
#> 217 motif 1 AT5G64310 22 342 347 11.934
#> 218 motif 1 AT5G64310 22 586 591 11.934
#> 219 motif 1 AT5G64310 22 592 597 11.934
#> 220 motif 1 AT5G64310 22 696 701 11.934
#> match thresh.score min.score max.score score.pct strand
#> <character> <numeric> <numeric> <numeric> <numeric> <character>
#> 1 AAAAAA 10.7406 -39.948 11.934 100 -
#> 2 AAAAAA 10.7406 -39.948 11.934 100 +
#> 3 AAAAAA 10.7406 -39.948 11.934 100 +
#> 4 AAAAAA 10.7406 -39.948 11.934 100 -
#> 5 AAAAAA 10.7406 -39.948 11.934 100 -
#> ... ... ... ... ... ... ...
#> 216 AAAAAA 10.7406 -39.948 11.934 100 -
#> 217 AAAAAA 10.7406 -39.948 11.934 100 +
#> 218 AAAAAA 10.7406 -39.948 11.934 100 +
#> 219 AAAAAA 10.7406 -39.948 11.934 100 +
#> 220 AAAAAA 10.7406 -39.948 11.934 100 +
#> pvalue qvalue
#> <numeric> <numeric>
#> 1 0.000244141 0.0494745
#> 2 0.000244141 0.0494745
#> 3 0.000244141 0.0494745
#> 4 0.000244141 0.0494745
#> 5 0.000244141 0.0494745
#> ... ... ...
#> 216 0.000244141 0.0494745
#> 217 0.000244141 0.0494745
#> 218 0.000244141 0.0494745
#> 219 0.000244141 0.0494745
#> 220 0.000244141 0.0494745Finally, the results can be returned as a GRanges object
for further manipulation:
scan_sequences(motif.k2, ArabidopsisPromoters, RC = TRUE,
threshold = 0.9, threshold.type = "logodds",
return.granges = TRUE)
#> GRanges object with 94 ranges and 11 metadata columns:
#> seqnames ranges strand | motif motif.i sequence.i score
#> <Rle> <IRanges> <Rle> | <character> <integer> <integer> <numeric>
#> [1] AT1G03850 203-209 + | motif 1 4 9.08
#> [2] AT1G03850 328-334 - | motif 1 4 9.08
#> [3] AT1G03850 707-713 - | motif 1 4 9.08
#> [4] AT1G05670 700-706 - | motif 1 47 9.08
#> [5] AT1G06160 956-962 + | motif 1 48 9.08
#> ... ... ... ... . ... ... ... ...
#> [90] AT5G22690 362-368 + | motif 1 46 9.08
#> [91] AT5G22690 52-58 - | motif 1 46 9.08
#> [92] AT5G24660 140-146 - | motif 1 49 9.08
#> [93] AT5G58430 332-338 + | motif 1 16 9.08
#> [94] AT5G58430 343-349 + | motif 1 16 9.08
#> match thresh.score min.score max.score score.pct pvalue
#> <character> <numeric> <numeric> <numeric> <numeric> <numeric>
#> [1] CTAATCC 8.172 -19.649 9.08 100 0.000976562
#> [2] CTTTTCC 8.172 -19.649 9.08 100 0.000976562
#> [3] CTTAACC 8.172 -19.649 9.08 100 0.000976562
#> [4] CTTTACC 8.172 -19.649 9.08 100 0.000976562
#> [5] CTAATCC 8.172 -19.649 9.08 100 0.000976562
#> ... ... ... ... ... ... ...
#> [90] CAAATCC 8.172 -19.649 9.08 100 0.000976562
#> [91] CATTACC 8.172 -19.649 9.08 100 0.000976562
#> [92] CATTACC 8.172 -19.649 9.08 100 0.000976562
#> [93] CATAACC 8.172 -19.649 9.08 100 0.000976562
#> [94] CAAATCC 8.172 -19.649 9.08 100 0.000976562
#> qvalue
#> <numeric>
#> [1] 1
#> [2] 1
#> [3] 1
#> [4] 1
#> [5] 1
#> ... ...
#> [90] 1
#> [91] 1
#> [92] 1
#> [93] 1
#> [94] 1
#> -------
#> seqinfo: 50 sequences from an unspecified genomescan_sequences_lite()For DNA or RNA scans that do not need multifreq scoring, gapped
motifs, q-values, exhaustive P-values, or any threshold type other than
a P-value, the lighter scan_sequences_lite() is generally
faster, and it parallelises rather better across motifs. Internally it
uses the same C++ scanner, computes its per-hit P-values via the same
FIMO-style dynamic-programming algorithm, and returns the same set of
hits; it simply skips the extra work that scan_sequences()
has to do in order to support its broader feature set.
The default surface of scan_sequences_lite() is
deliberately minimal (just six formals: motifs,
sequences, pvalue = 1e-4,
RC = TRUE, nthreads = 1, and
return.granges = NULL). When GenomicRanges is
installed the default output is a GRanges, and otherwise it
falls back to a data.frame. The coordinates always satisfy
start <= end regardless of strand (following the BED /
GFF / GRanges convention), and on --strand
hits the match column holds the reverse complement of the
sequence substring, that is, the matched orientation. Greedy hit-level
deduplication is available via no.overlaps = TRUE, and is
also exposed as a standalone dedup_hits() function for
post-processing.
## scan_sequences_lite() with all defaults
hits <- scan_sequences_lite(ArabidopsisMotif, ArabidopsisPromoters)
## Optional deduplication of overlapping hits
hits <- scan_sequences_lite(ArabidopsisMotif, ArabidopsisPromoters,
no.overlaps = TRUE)When scan_sequences() is called with arguments that
happen to map cleanly onto scan_sequences_lite()’s feature
set, it emits a one-line hint pointing you at the faster function. (This
can be silenced with
options(universalmotif.suggest.scan_sequences_lite = FALSE).)
motifmatchr and
yamtkTo put these trade-offs in some perspective, the table below records
the end-to-end wall-clock time for the four scanners on a single shared
fixture: the first 50 motifs of HOCOMOCOv11, scanned against random DNA
at five different sizes, with a P-value cutoff of \(5 \times 10^{-5}\), both strands, and a
uniform background. motifmatchr::matchMotifs() appears in
two output modes, its default out = "matches" (one result
per (motif, sequence), which is strictly less work than the
other three tools do) and out = "positions" (per position,
and so directly comparable to the others). The hit sets from the CLI
tool yamtk,
scan_sequences(), scan_sequences_lite(), and
motifmatchr in positions mode all agree to
within about 5% (the small drift comes from yamtk building
its PWM from a continuous PPM, whereas universalmotif
rounds the PCM). Times are reported in seconds, and each cell shows
nthreads = 1 / nthreads = 4 wherever threading applies.
These benchmarks were run on an MBP M5 under R 4.4.1.
| Workload | yamtk | mm matches¹ | mm positions² | scan_sequences_lite | scan_sequences³ |
|---|---|---|---|---|---|
| 10 mot × 500 seq × 500 bp | 0.03 / 0.01 | 0.05 | 5.67 | 0.30 / 0.13 | 0.39 / 0.39 |
| 50 mot × 500 seq × 500 bp | 0.12 / 0.03 | 0.17 | 28.19 | 1.48 / 0.44 | 1.62 / 1.56 |
| 200 mot × 1000 seq × 500 bp | 0.71 / 0.20 | 0.71 | 237.32 | 6.62 / 1.91 | 7.02 / 6.46 |
| 50 mot × 100 seq × 50 kb | 1.34 / 0.37 | 0.30 | 6.09 | 3.71 / 1.11 | 3.79 / 2.18 |
| 200 mot × 100 seq × 50 kb | 5.17 / 1.49 | 1.12 | 24.83 | 14.92 / 4.40 | 15.50 / 9.01 |
¹ motifmatchr::matchMotifs(..., out = "matches")
(default): returns a sparse (motif × sequence) yes/no
matrix. Strictly less work than the per-position scanners; a fair
comparison only when you really only need to know whether each motif
matched each sequence at all.
² motifmatchr::matchMotifs(..., out = "positions"):
returns the full set of per-position hits as a list of
IRangesList. This is the fair comparison against
yamtk, scan_sequences(), and
scan_sequences_lite(). motifmatchr is
single-threaded from the R API in both modes.
³ scan_sequences(..., calc.pvals = TRUE), which performs
the same work per hit as scan_sequences_lite(). The older
mapply-based dispatch in scan_sequences()
parallelises poorly for short-sequence workloads; this is the main cost
that scan_sequences_lite() eliminates.
A few practical takeaways:
yamtk (a
dedicated CLI tool written in C) is the fastest scanner at every scale.
The universalmotif package does not aim to match it; the
goal is to stay within a small multiple while keeping everything inside
R.scan_sequences_lite() reaches within ~3× of
yamtk scan at 4 threads on long-sequence workloads, and is
2-3× faster than scan_sequences(calc.pvals = TRUE) at 4
threads across every configuration tested.scan_sequences_lite() is also substantially faster than
motifmatchr::matchMotifs(out = "positions") at every scale:
5-100× depending on the input.motifmatchr is faster than the per-position scanners
only in its default out = "matches" mode, where it skips
per-position reporting entirely. Choose that mode when “did this motif
match this sequence at all?” is the question you are actually
asking.scan_sequences()’s advanced features, I would generally
reach for scan_sequences_lite().A few suggestions for different ways of plotting hits across sequences are presented here.
Using the ggbio package, it is rather trivial to
generate nice visualisations of the output of
scan_sequences(). This requires having the
GenomicRanges and ggbio packages installed,
and outputting the scan_sequences() result as a
GRanges object (via
return.granges = TRUE).
library(universalmotif)
library(GenomicRanges)
library(ggbio)
data(ArabidopsisPromoters)
motif1 <- create_motif("AAAAAA", name = "Motif A")
motif2 <- create_motif("CWWWWCC", name = "Motif B")
res <- scan_sequences(c(motif1, motif2), ArabidopsisPromoters[1:10],
return.granges = TRUE, calc.pvals = TRUE, no.overlaps = TRUE,
threshold = 0.2, threshold.type = "logodds")
## Just plot the motif hits:
autoplot(res, layout = "karyogram", aes(fill = motif, color = motif)) +
theme(
strip.background = element_rect(fill = NA, colour = NA),
panel.background = element_rect(fill = NA, colour = NA)
)
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.
## Plot Motif A hits by P-value:
autoplot(res[res$motif.i == 1, ], layout = "karyogram",
aes(fill = log10(pvalue), colour = log10(pvalue))) +
scale_fill_gradient(low = "black", high = "grey75") +
scale_colour_gradient(low = "black", high = "grey75") +
theme(
strip.background = element_rect(fill = NA, colour = NA),
panel.background = element_rect(fill = NA, colour = NA)
)
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.Alternatively, just a simple heatmap with only
ggplot2.
library(universalmotif)
library(ggplot2)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)
res <- scan_sequences(ArabidopsisMotif, ArabidopsisPromoters,
threshold = 0, threshold.type = "logodds.abs")
res <- suppressWarnings(as.data.frame(res))
res$x <- mapply(function(x, y) mean(c(x, y)), res$start, res$stop)
ggplot(res, aes(x, sequence, fill = score)) +
scale_fill_viridis_c() +
scale_x_continuous(expand = c(0, 0), limits = c(0, 1000)) +
xlab(element_blank()) +
ylab(element_blank()) +
geom_tile(width = ncol(ArabidopsisMotif)) +
theme_bw() +
theme(panel.grid = element_blank(), axis.text.y = element_text(size = 6))
#> Warning: Removed 2 rows containing missing values or values outside the scale range
#> (`geom_tile()`).
#> Warning: `label` cannot be a <ggplot2::element_blank> object.
#> `label` cannot be a <ggplot2::element_blank> object.Using packages such as ggExtra or ggpubr,
one could even plot marginal histogram or density plots above or below
to illustrate any motif positional preference within the sequences.
(Though keep in mind that the hit coordinates and sequence lengths would
need to be normalized if not all sequences were of the same length, as
they are here.)
Finally, the distribution of all possible motif scores could be shown as a line plot across the sequences.
library(universalmotif)
library(ggplot2)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)
res <- scan_sequences(ArabidopsisMotif, ArabidopsisPromoters[1:5],
threshold = -Inf, threshold.type = "logodds.abs")
res <- suppressWarnings(as.data.frame(res))
res$position <- mapply(function(x, y) mean(c(x, y)), res$start, res$stop)
ggplot(res, aes(position, score, colour = score)) +
geom_line() +
geom_hline(yintercept = 0, colour = "red", alpha = 0.3) +
theme_bw() +
scale_colour_viridis_c() +
facet_wrap(~sequence, ncol = 1) +
xlab(element_blank()) +
ylab(element_blank()) +
theme(strip.background = element_blank())
#> Warning: `label` cannot be a <ggplot2::element_blank> object.
#> `label` cannot be a <ggplot2::element_blank> object.The universalmotif package offers the ability to search
for enriched motif sites in a set of sequences via
enrich_motifs() / enrich_motifs_lite(). There
is little complexity to this, as it simply runs
scan_sequences() twice: once on a set of target sequences,
and once on a set of background sequences. After which the results
between the two sequences are collated and run through enrichment tests.
The background sequences can be given explicitly, or else
enrich_motifs() / enrich_motifs_lite() will
create background sequences on its own by using
shuffle_sequences() on the target sequences.
Let us consider the following basic example:
library(universalmotif)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)
enrich_motifs(ArabidopsisMotif, ArabidopsisPromoters, shuffle.k = 3,
threshold = 0.001, RC = TRUE)
#> DataFrame with 1 row and 15 columns
#> motif motif.i motif.consensus target.hits target.seq.hits
#> <character> <integer> <character> <integer> <integer>
#> 1 YTTTYTTTTTYTTTY 1 YTYTYTTYTTYTTTY 244 50
#> target.seq.count bkg.hits bkg.seq.hits bkg.seq.count Pval Qval
#> <integer> <integer> <integer> <integer> <numeric> <numeric>
#> 1 50 151 49 50 1.72467e-06 1.72467e-06
#> Eval pct.target.seq.hits pct.bkg.seq.hits target.enrichment
#> <numeric> <numeric> <numeric> <numeric>
#> 1 3.44934e-06 100 98 1.02041Here we can see that the motif is significantly enriched in the
target sequences. The Pval was calculated by calling
stats::fisher.test().
One final point: always keep in mind the threshold
parameter, as this will ultimately decide the number of hits found. (A
bad threshold can lead to a false negative.)
enrich_motifs_lite()For the common case (DNA/RNA motifs, a P-value hit threshold,
Fisher’s exact test, and Benjamini-Hochberg q-values),
enrich_motifs_lite() offers a stripped-down counterpart to
enrich_motifs(). It is built on top of
scan_sequences_lite(), and so inherits its speed
advantages.
library(universalmotif)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)
enrich_motifs_lite(ArabidopsisMotif, ArabidopsisPromoters,
pvalue = 1e-3, qvalue = 0.1, rng.seed = 1, test = "sites")
#> motif motif.i consensus target.seq.n target.seq.hits
#> 1 YTTTYTTTTTYTTTY 1 YTYTYTTYTTYTTTY 50 50
#> target.site.hits bkg.seq.n bkg.seq.hits bkg.site.hits enrichment
#> 1 683 50 48 252 2.710317
#> log2.enrichment pvalue qvalue
#> 1 1.438462 5.602412e-47 5.602412e-47Note the test = "sites" here. The two functions default
to different tests: enrich_motifs() defaults to
mode = "total.hits" (a per-site comparison), while
enrich_motifs_lite() defaults to test = "seqs"
(a per-sequence comparison). Setting test = "sites" makes
enrich_motifs_lite() mirror the
enrich_motifs() call above. The per-sequence test would be
a poor fit for this particular example anyway: the promoters are long
(1000 bp) and the motif is a low-complexity poly-pyrimidine that appears
in nearly every sequence of both the target and the shuffled background,
so per-sequence presence barely differs between them and the enrichment
is only marginally significant.
The output is a plain data.frame with 13 columns:
motif, motif.i, consensus,
target.seq.n, target.seq.hits,
target.site.hits, bkg.seq.n,
bkg.seq.hits, bkg.site.hits,
enrichment, log2.enrichment,
pvalue, qvalue.
Two test modes are supported:
test = "seqs" (default): Fisher’s exact on per-sequence
hit presence, equivalent to
enrich_motifs(mode = "seq.hits").test = "sites": Fisher’s exact on per-position rates,
equivalent to enrich_motifs(mode = "total.hits").When an enrich_motifs() call uses only features that map
cleanly onto enrich_motifs_lite(), a one-line hint is again
emitted pointing you at the leaner function. (Silence it with
options(universalmotif.suggest.enrich_motifs_lite = FALSE).)
motif_finder() is a de novo motif discovery
function. For each motif width in a configurable range, it enumerates
the over-represented k-mer seeds (using a Fisher’s exact test on
per-sequence presence against a background set), aligns the
Hamming-distance-1 neighbours of the best seed to form a PPM, refines
that PPM over two re-scan passes, accepts the motif if its Fisher’s
exact p-value passes stop.pvalue, and then masks the
covered positions and repeats, up to nmotifs times per
width. Once every width has been processed, the motifs are deduplicated
across widths, BH-adjusted, and IC-trimmed at the flanks.
library(universalmotif)
library(Biostrings)
set.seed(1)
seqs <- create_sequences(seqnum = 100, seqlen = 200, rng.seed = 1)
## Plant a motif in 80 of the 100 sequences:
planted <- DNAString("TTGACATA")
for (i in seq_len(80)) {
pos <- sample.int(200 - 8, 1)
subseq(seqs[[i]], start = pos, width = 8) <- planted
}
motifs <- motif_finder(seqs, rng.seed = 1, min.width = 6, max.width = 10)
motifs[, c("name", "consensus", "width", "seqs_pos", "seqs_neg", "pvalue", "qvalue")]The return shape is a universalmotif_df: one row per
discovered motif, with the motif S4 objects sitting in the
motif list-column, and the standard to_df()
slot columns (name, consensus,
alphabet, and so on) joined to the discovery-specific stats
(rank, width, seqs_pos,
seqs_neg, sites_pos, sites_neg,
n_pos, n_neg, pvalue,
qvalue). A call to to_list() recovers a plain
list of universalmotif S4 objects, which then plug directly
into view_motifs_lite(),
compare_motifs_lite(), write_meme(), and the
rest of the package.
The discovery widths default to 6 through 15, the per-width motif cap
to 10, and the result-level q-value filter to 1e-3; set
qvalue = 1 if you would rather have all of the discovered
motifs returned regardless of significance. Unless they are supplied
explicitly through bkg.sequences, the background sequences
are auto-generated by k=2 shuffling of the input.
motif_peaks()motif_peaks() tests whether motif hits cluster
non-uniformly along the input sequences. It implements an analytical, CentriMo-style test: under
the null hypothesis that hit positions are uniform over
[1, seq.length], the number of hits falling in a candidate
window follows a binomial distribution. The function reports the
most-enriched window for each motif, Bonferroni-corrected across the
windows tested and then BH-adjusted across the motifs.
Two modes are supported:
mode = "central" (default): only centre-of-sequence
windows are tested. Appropriate when input sequences are centred on a
reference position (e.g. ChIP-seq peak summits).mode = "local": the window centre is also varied,
scanning the whole sequence for any positionally-enriched region.library(universalmotif)
library(Biostrings)
set.seed(1)
seqs <- create_sequences(seqnum = 200, seqlen = 500, rng.seed = 1)
planted <- DNAString("TTGACATA")
## Plant in 150 of 200 sequences, centred on position 250 (+/- 4 bp).
for (i in seq_len(150)) {
pos <- 246L + sample.int(8, 1) - 1L
subseq(seqs[[i]], start = pos, width = 8) <- planted
}
m <- create_motif("TTGACATA", name = "test")
## Scan sequences, then test for central enrichment.
hits <- scan_sequences_lite(m, seqs, pvalue = 1e-3, return.granges = TRUE)
peaks <- motif_peaks(hits)
peaks[, c("motif", "best.window", "best.center", "hits.in", "nhits",
"enrichment", "pvalue", "qvalue")]
## Visualise the per-motif positional distribution + best window.
plot_motif_peaks(peaks)The returned data.frame carries one row per significant
motif, together with a list-column centers holding the
best-hit centre positions per sequence. plot_motif_peaks()
consumes that column directly, so there is no need to thread your
original scan results back through it.
The input is polymorphic: motif_peaks() will accept
either a data.frame or a GRanges coming out of
scan_sequences() or scan_sequences_lite().
When the input is a GRanges that has its
seqlengths() set (which scan_sequences_lite()
does for you automatically), seq.length is inferred;
otherwise you will need to pass it explicitly.
motif_proximity()motif_peaks() assumes equal-length sequences centred on
a reference position. When you instead have motif hits scattered across
whole chromosomes together with a set of anchor coordinates
(peak summits, TSSs, SNPs, or another factor’s binding sites),
motif_proximity() tests whether the hits sit closer to
those anchors than chance. It is the genome-wide sibling of
motif_peaks(), sharing the same binomial engine but
measuring distance to the nearest anchor rather than position within a
fixed window.
Three null models are available through method:
"binomial" (default): for each candidate distance
d, the fraction of the scanned genome lying within
d of an anchor is the success probability of a binomial
test on the hit count. This is fast, but the uniform-hit null cannot
correct for composition bias."permutation": the anchors (not the hits) are
randomised within the scanned genome to build an empirical null. Because
the real hits stay fixed, this absorbs composition and mappability bias,
and so it is the method to prefer when such bias is plausible. Call
set.seed() beforehand for reproducible p-values."ks": a threshold-free Kolmogorov-Smirnov test of the
per-hit distance-to-nearest-anchor against its analytical null.count = "hits" (the default) collapses overlapping hits
of a motif to one representative before counting hits near anchors,
whereas count = "anchors" instead counts the fraction of
anchors that have a nearby hit.
You can supply a hit table directly, or let
motif_proximity() scan for you by passing
motifs and sequences (an
XStringSet, or a BSgenome, in which case only
the chromosomes carrying anchors are scanned):
library(universalmotif)
library(Biostrings)
library(GenomicRanges)
## Treat three created sequences as small chromosomes of unequal length.
set.seed(1)
chrs <- c(create_sequences(seqnum = 1, seqlen = 6000, rng.seed = 1),
create_sequences(seqnum = 1, seqlen = 4000, rng.seed = 2),
create_sequences(seqnum = 1, seqlen = 3000, rng.seed = 3))
names(chrs) <- paste0("chr", 1:3)
## Plant a motif a few bp downstream of a set of anchors on chr1.
anchor.pos <- seq(500, 5500, by = 250)
planted <- DNAString("TTGACATA")
for (p in anchor.pos)
subseq(chrs[["chr1"]], start = p + 5L, width = 8) <- planted
anchors <- GRanges("chr1", IRanges(anchor.pos, width = 1), strand = "+")
m <- create_motif("TTGACATA", name = "anchored")
## Either pass a hit table ...
hits <- scan_sequences_lite(m, chrs, pvalue = 1e-3, return.granges = TRUE)
motif_proximity(hits, anchors)
## ... or let motif_proximity() scan internally (scan.pvalue mirrors the
## pvalue used above, so the two calls are equivalent).
motif_proximity(motifs = m, sequences = chrs, anchors = anchors,
scan.pvalue = 1e-3)The universe (the null support) defaults to the whole chromosomes
implied by seqlengths(hits), and only chromosomes carrying
at least one anchor are kept. For masked or partial scans, pass the
scanned regions explicitly through universe; otherwise the
within-distance fraction is overstated and the test becomes
anti-conservative.
Anchor width matters as much as their positions. The near zone is
each anchor widened by the distance on either side, so wide anchors
enlarge the within-distance fraction, drive the enrichment toward one,
and collapse a hit’s distance to zero whenever it falls inside the
region. If the question is enrichment near a point (summits, TSSs,
SNPs), use 1 bp anchors and reduce regions to their reference position
first, for example resize(peaks, width = 1, fix = "center")
or the called summit. Feeding raw, wide peaks instead can silently gut
the test even when the signal is strong. Keep regions only when you
genuinely mean “within or around these intervals”, and then choose
dist.thresholds relative to their width.
Because the anchors are a GRanges, their strand can
drive a directional test. With stranded anchors such as TSSs,
orientation = "upstream" or "downstream"
builds a strand-aware one-sided zone, so a motif enriched downstream of
the feature is distinguished from one enriched upstream (the motif above
was planted downstream of the + anchors):
motif_proximity(hits, anchors, orientation = "downstream")
motif_proximity(hits, anchors, orientation = "upstream")plot_motif_proximity() shows the per-hit distances to
the nearest anchor, faceted by motif, with the most-enriched zone
shaded. When the anchors are stranded the distances are signed, so
upstream and downstream fall on opposite sides of zero:
universalmotif class motifs can be gapped, which can be
used by scan_sequences() and enrich_motifs().
Note that gapped motif support is currently limited to these two
functions. All other functions will ignore the gap information, and even
discard them in functions such as merge_motifs().
First, obtain the component motifs:
library(universalmotif)
data(ArabidopsisPromoters)
m1 <- create_motif("TTTATAT", name = "PartA")
m2 <- create_motif("GGTTCGA", name = "PartB")Then, combine them and add the desired gap. In this case, a gap will be added between the two motifs which can range in size from 4-6 bases.
m <- cbind(m1, m2)
m <- add_gap(m, gaploc = ncol(m1), mingap = 4, maxgap = 6)
m
#>
#> Motif name: PartA/PartB
#> Alphabet: DNA
#> Type: PCM
#> Strands: +-
#> Total IC: 28
#> Pseudocount: 0
#> Consensus: TTTATAT..GGTTCGA
#> Target sites: 1
#> Gap locations: 7-8
#> Gap sizes: 4-6
#>
#> T T T A T A T G G T T C G A
#> A 0 0 0 1 0 1 0 .. 0 0 0 0 0 0 1
#> C 0 0 0 0 0 0 0 .. 0 0 0 0 1 0 0
#> G 0 0 0 0 0 0 0 .. 1 1 0 0 0 1 0
#> T 1 1 1 0 1 0 1 .. 0 0 1 1 0 0 0Now, it can be used directly in scan_sequences() or
enrich_motifs():
Highly-repetitive low complexity regions can oftentimes cause
problems during de novo motif discovery, leading to obviously
false motifs being returned. One way to get around this issue is to
preemptively remove or mask these regions. The
universalmotif package includes a few functions which can
help carry out this task.
Using mask_seqs(), one can mask a specific pattern of
letters in XStringSet objects. Consider the following
sequences:
library(universalmotif)
library(Biostrings)
Ex.seq <- DNAStringSet(c(
A = "GTTGAAAAAAAAAAAAAAAACAGACGT",
B = "TTAGATGGCCCATAGCTTATACGGCAA",
C = "AATAAAATGCTTAGGAAATCGATTGCC"
))We can easily mask portions that contain, say, stretches of at least
8 As:
mask_seqs(Ex.seq, "AAAAAAAA")
#> DNAStringSet object of length 3:
#> width sequence names
#> [1] 27 GTTG----------------CAGACGT A
#> [2] 27 TTAGATGGCCCATAGCTTATACGGCAA B
#> [3] 27 AATAAAATGCTTAGGAAATCGATTGCC CAlternatively, instead of masking a known stretch of letters, one can
find low complexity regions using sequence_complexity(),
and then mask specific regions in the sequences using
mask_ranges(). The sequence_complexity()
function has several complexity metrics available: the Wootton-Federhen
(Wootton and Federhen 1993) and Trifonov
(Trifonov 1990) algorithms (and their
approximations) are well described in Orlov and
Potapov (2004), and DUST in Morgulis et
al. (2006). See ?sequence_complexity for more
details.
(Ex.DUST <- sequence_complexity(Ex.seq, window.size = 10, method = "DUST",
return.granges = TRUE))
#> GRanges object with 15 ranges and 1 metadata column:
#> seqnames ranges strand | complexity
#> <Rle> <IRanges> <Rle> | <numeric>
#> [1] A 1-10 * | 0.857143
#> [2] A 6-15 * | 4.000000
#> [3] A 11-20 * | 4.000000
#> [4] A 16-25 * | 0.428571
#> [5] A 21-27 * | 0.000000
#> ... ... ... ... . ...
#> [11] C 1-10 * | 0.285714
#> [12] C 6-15 * | 0.000000
#> [13] C 11-20 * | 0.000000
#> [14] C 16-25 * | 0.000000
#> [15] C 21-27 * | 0.000000
#> -------
#> seqinfo: 3 sequences from an unspecified genomeUsing the DUST algorithm, we can see there are a couple of regions
which spike in the complexity score (for this particular algorithm, more
complex sequences converge towards zero). Now it is only a matter of
filtering for those regions and using mask_ranges().
(Ex.DUST <- Ex.DUST[Ex.DUST$complexity >= 3])
#> GRanges object with 2 ranges and 1 metadata column:
#> seqnames ranges strand | complexity
#> <Rle> <IRanges> <Rle> | <numeric>
#> [1] A 6-15 * | 4
#> [2] A 11-20 * | 4
#> -------
#> seqinfo: 3 sequences from an unspecified genome
mask_ranges(Ex.seq, Ex.DUST)
#> DNAStringSet object of length 3:
#> width sequence names
#> [1] 27 GTTGA---------------CAGACGT A
#> [2] 27 TTAGATGGCCCATAGCTTATACGGCAA B
#> [3] 27 AATAAAATGCTTAGGAAATCGATTGCC CNow these sequences could be used directly with
scan_sequences() or written to a fasta file using
Biostrings::writeXStringSet() for use with an external
de novo motif discovery program such as MEME.
Note: In the time since the inception of the
run_meme() function, Sabrina Nystrom (a contributor to
universalmotif) has created the memes package
as an interface to much of the MEME suite. It is fully
interoperable with the universalmotif package and provides
a much more convenient way to run MEME programs from within
R. Install it from Bioconductor with
BiocManager::install("memes").
The universalmotif package provides a simple wrapper to
the powerful motif discovery tool MEME (Bailey and Elkan 1994). To run an analysis with
MEME, all that is required is a set of
XStringSet class sequences (defined in the
Biostrings package), and run_meme() will take
care of running the program and reading the output for use within
R.
The first step is to check that R can find the MEME
binary in your $PATH by running run_meme()
without any parameters. If successful, you should see the default
MEME help message in your console. If not, then you’ll need
to provide the complete path to the MEME binary. There are
two options:
library(universalmotif)
## 1. Once per session: via `options()`
options(meme.bin = "/path/to/meme/bin/meme")
run_meme(...)
## 2. Once per run: via `run_meme()`
run_meme(..., bin = "/path/to/meme/bin/meme")Now we need to get some sequences to use with
run_meme(). At this point we can read sequences from disk
or extract them from one of the Bioconductor
BSgenome packages.
library(universalmotif)
data(ArabidopsisPromoters)
## 1. Read sequences from disk (in fasta format):
library(Biostrings)
# The following `read*()` functions are available in Biostrings:
# DNA: readDNAStringSet
# DNA with quality scores: readQualityScaledDNAStringSet
# RNA: readRNAStringSet
# Amino acid: readAAStringSet
# Any: readBStringSet
sequences <- readDNAStringSet("/path/to/sequences.fasta")
run_meme(sequences, ...)
## 2. Extract from a `BSgenome` object:
library(GenomicFeatures)
library(TxDb.Athaliana.BioMart.plantsmart28)
library(BSgenome.Athaliana.TAIR.TAIR9)
# Let us retrieve the same promoter sequences from ArabidopsisPromoters:
gene.names <- names(ArabidopsisPromoters)
# First get the transcript coordinates from the relevant `TxDb` object:
transcripts <- transcriptsBy(TxDb.Athaliana.BioMart.plantsmart28,
by = "gene")[gene.names]
# There are multiple transcripts per gene, we only care for the first one
# in each:
transcripts <- lapply(transcripts, function(x) x[1])
transcripts <- unlist(GRangesList(transcripts))
# Then the actual sequences:
# Unfortunately this is a case where the chromosome names do not match
# between the two databases
seqlevels(TxDb.Athaliana.BioMart.plantsmart28)
#> [1] "1" "2" "3" "4" "5" "Mt" "Pt"
seqlevels(BSgenome.Athaliana.TAIR.TAIR9)
#> [1] "Chr1" "Chr2" "Chr3" "Chr4" "Chr5" "ChrM" "ChrC"
# So we must first rename the chromosomes in `transcripts`:
seqlevels(transcripts) <- seqlevels(BSgenome.Athaliana.TAIR.TAIR9)
# Finally we can extract the sequences
promoters <- getPromoterSeq(transcripts,
BSgenome.Athaliana.TAIR.TAIR9,
upstream = 1000, downstream = 0)
run_meme(promoters, ...)Once the sequences are ready, there are a few important options to
keep in mind. One is whether to conserve the output from
MEME. The default is not to, but this can be changed by
setting the relevant option:
The second important option is the search function
(objfun). Some search functions such as the default
classic do not require a set of background sequences,
whilst some do (such as de). If you choose one of the
latter, then you can either let MEME create them for you
(it will shuffle the target sequences) or you can provide them via the
control.sequences parameter.
Finally, choose how you’d like the data imported into R.
Once the MEME program exits, run_meme() will
import the results into R with read_meme(). At
this point you can decide if you want just the motifs themselves
(readsites = FALSE) or if you’d like the original sequence
sites as well (readsites = TRUE, the default). Doing the
latter gives you the option of generating higher order representations
for the imported MEME motifs as shown here:
There are a wealth of other MEME options available, such
as the number of desired motifs (nmotifs), the width of
desired motifs (minw, maxw), the search mode
(mod), assigning sequence weights (weights),
using a custom alphabet (alph), and many others. See the
output from run_meme() for a brief description of the
options, or visit the online manual for more
details.
Since biological sequences are usually contained in
XStringSet class objects,
sequence_complexity(), get_bkg() and
shuffle_sequences() are designed to work with such objects.
For cases when strings are not XStringSet objects, the
following functions are available:
calc_complexity(): alternative to
sequence_complexity()count_klets(): alternative to
get_bkg()shuffle_string(): alternative to
shuffle_sequences()library(universalmotif)
string <- "DASDSDDSASDSSA"
calc_complexity(string)
#> [1] 0.7823323
count_klets(string, 2)
#> klets counts
#> 1 AA 0
#> 2 AD 0
#> 3 AS 2
#> 4 DA 1
#> 5 DD 1
#> 6 DS 3
#> 7 SA 2
#> 8 SD 3
#> 9 SS 1
shuffle_string(string, 2)
#> [1] "DDSDSSDSASDASA"A few other utilities have also been made available (based on the
internal code of other universalmotif functions) that work
on simple character vectors:
calc_windows(): calculate the coordinates for sliding
windows from 1 to any number nget_klets(): get a list of all possible
k-lets for any sequence alphabetslide_fun(): apply a function over sliding windows
across a single stringwindow_string(): retrieve characters from sliding
windows of a single stringlibrary(universalmotif)
calc_windows(n = 12, window = 4, overlap = 2)
#> start stop
#> 1 1 4
#> 2 3 6
#> 3 5 8
#> 4 7 10
#> 5 9 12
get_klets(c("A", "S", "D"), 2)
#> [1] "AA" "AS" "AD" "SA" "SS" "SD" "DA" "DS" "DD"
slide_fun("ABCDEFGH", charToRaw, raw(2), window = 2, overlap = 1)
#> [,1] [,2] [,3] [,4] [,5] [,6] [,7]
#> [1,] 41 42 43 44 45 46 47
#> [2,] 42 43 44 45 46 47 48
window_string("ABCDEFGH", window = 2, overlap = 1)
#> [1] "AB" "BC" "CD" "DE" "EF" "FG" "GH"#> R version 4.6.1 (2026-06-24)
#> Platform: x86_64-pc-linux-gnu
#> Running under: Ubuntu 26.04.1 LTS
#>
#> Matrix products: default
#> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3
#> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.32.so; LAPACK version 3.12.0
#>
#> locale:
#> [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C
#> [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8
#> [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8
#> [7] LC_PAPER=en_US.UTF-8 LC_NAME=C
#> [9] LC_ADDRESS=C LC_TELEPHONE=C
#> [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C
#>
#> time zone: Etc/UTC
#> tzcode source: system (glibc)
#>
#> attached base packages:
#> [1] stats4 stats graphics grDevices utils datasets methods
#> [8] base
#>
#> other attached packages:
#> [1] ggbio_1.61.0
#> [2] TFBSTools_1.51.0
#> [3] dplyr_1.2.1
#> [4] ggtree_4.3.0
#> [5] ggplot2_4.0.3
#> [6] MotifDb_1.55.0
#> [7] BSgenome.Athaliana.TAIR.TAIR9_1.3.1000
#> [8] BSgenome_1.81.1
#> [9] BiocIO_1.23.3
#> [10] rtracklayer_1.73.0
#> [11] GenomeInfoDb_1.49.1
#> [12] GenomicRanges_1.65.4
#> [13] Biostrings_2.81.9
#> [14] Seqinfo_1.3.2
#> [15] XVector_0.53.0
#> [16] IRanges_2.47.5
#> [17] S4Vectors_0.51.10
#> [18] BiocGenerics_0.59.12
#> [19] generics_0.1.4
#> [20] universalmotif_1.31.54
#> [21] bookdown_0.48
#>
#> loaded via a namespace (and not attached):
#> [1] bitops_1.1-0 ggplotify_0.1.3
#> [3] tibble_3.3.1 graph_1.91.0
#> [5] XML_3.99-0.24 rpart_4.1.27
#> [7] DirichletMultinomial_1.55.0 lifecycle_1.0.5
#> [9] pwalign_1.9.1 lattice_0.23-1
#> [11] ensembldb_2.37.3 MASS_7.3-66
#> [13] OrganismDbi_1.55.1 backports_1.5.1
#> [15] magrittr_2.0.5 Hmisc_5.3-0
#> [17] sass_0.4.10 rmarkdown_2.32
#> [19] jquerylib_0.1.4 yaml_2.3.12
#> [21] otel_0.2.0 grImport2_0.3-3
#> [23] DBI_1.3.0 buildtools_1.0.0
#> [25] RColorBrewer_1.1-3 ade4_1.7-24
#> [27] abind_1.4-8 purrr_1.2.2
#> [29] AnnotationFilter_1.37.0 biovizBase_1.61.0
#> [31] RCurl_1.98-1.20 yulab.utils_0.2.5
#> [33] nnet_7.3-21 VariantAnnotation_1.59.4
#> [35] rappdirs_0.3.4 gdtools_0.5.1
#> [37] tidytree_0.4.8 maketools_1.3.2
#> [39] seqLogo_1.79.0 codetools_0.2-20
#> [41] DelayedArray_0.39.6 tidyselect_1.2.1
#> [43] ggseqlogo_0.2.2 aplot_0.3.1
#> [45] UCSC.utils_1.9.0 farver_2.1.2
#> [47] matrixStats_1.5.0 base64enc_0.1-6
#> [49] GenomicAlignments_1.49.2 jsonlite_2.0.0
#> [51] motifStack_1.57.0 Formula_1.2-6
#> [53] systemfonts_1.3.2 tools_4.6.1
#> [55] treeio_1.37.0 TFMPvalue_1.0.0
#> [57] Rcpp_1.1.2 glue_1.8.1
#> [59] gridExtra_2.3.1 SparseArray_1.13.2
#> [61] BiocBaseUtils_1.15.1 xfun_0.61
#> [63] MatrixGenerics_1.25.0 withr_3.0.3
#> [65] BiocManager_1.30.27 fastmap_1.2.0
#> [67] caTools_1.18.4 digest_0.6.39
#> [69] R6_2.6.1 gridGraphics_0.5-1
#> [71] colorspace_2.1-3 gtools_3.9.5
#> [73] jpeg_0.1-11 dichromat_2.0-1
#> [75] RSQLite_3.53.3 cigarillo_1.3.1
#> [77] tidyr_1.3.2 fontLiberation_0.1.0
#> [79] data.table_1.18.6.1 httr_1.4.9
#> [81] htmlwidgets_1.6.4 S4Arrays_1.13.0
#> [83] pkgconfig_2.0.3 gtable_0.3.6
#> [85] blob_1.3.0 S7_0.2.2
#> [87] sys_3.4.3 htmltools_0.5.9
#> [89] fontBitstreamVera_0.1.1 RBGL_1.89.0
#> [91] ProtGenerics_1.45.0 scales_1.4.0
#> [93] Biobase_2.73.2 png_0.1-9
#> [95] ggfun_0.2.1 knitr_1.52
#> [97] rstudioapi_0.19.0 reshape2_1.4.5
#> [99] rjson_0.2.23 checkmate_2.3.4
#> [101] nlme_3.1-171 curl_8.0.0
#> [103] cachem_1.1.0 stringr_1.6.0
#> [105] parallel_4.6.1 foreign_0.8-91
#> [107] AnnotationDbi_1.75.2 restfulr_0.0.17
#> [109] pillar_1.11.1 grid_4.6.1
#> [111] vctrs_0.7.3 cluster_2.1.8.3
#> [113] htmlTable_2.5.0 evaluate_1.0.5
#> [115] GenomicFeatures_1.65.0 cli_3.6.6
#> [117] compiler_4.6.1 Rsamtools_2.29.0
#> [119] rlang_1.3.0 crayon_1.5.3
#> [121] labeling_0.4.3 plyr_1.8.9
#> [123] fs_2.1.0 ggiraph_0.9.6
#> [125] stringi_1.8.9 viridisLite_0.4.3
#> [127] BiocParallel_1.47.0 lazyeval_0.2.3
#> [129] fontquiver_0.2.1 Matrix_1.7-6
#> [131] patchwork_1.3.2 bit64_4.8.6
#> [133] KEGGREST_1.53.6 SummarizedExperiment_1.43.0
#> [135] memoise_2.0.1 bslib_0.12.0
#> [137] bit_4.6.0 splitstackshape_1.4.8.1
#> [139] ape_5.8-1
scan_sequences_lite()enrich_motifs_lite()motif_peaks()motif_proximity()