biomaRt 2.69.3
Accessing the data available in Ensembl is by far most frequent use of the biomaRt package. With that in mind biomaRt provides a number of functions that are tailored to work specifically with the BioMart instances provided by Ensembl. This vignette details this Ensembl specific functionality and provides a number of example usecases that can be used as the basis for specifying your own queries.
Every analysis with biomaRt starts with selecting a BioMart database to use. The commands below will connect us to Ensembl’s most recent version of the Human Genes BioMart.
library(biomaRt)
ensembl <- useEnsembl(biomart = "genes", dataset = "hsapiens_gene_ensembl")
If this your first time using biomaRt , you might wonder how to find the two arguments we supplied to the useEnsembl() command. This is a two step process, but once you know the setting you need you can use the version shown above as a single command. These initial steps are outlined below.
The first step is to find the names of the BioMart services Ensembl is currently providing. We can do this using the function listEnsembl(), which will display all available Ensembl BioMart web services. The first column gives us the name we should provide to the biomart argument in useEnsembl(), and the second gives a more comprehensive title for the dataset along with the Ensembl version.
listEnsembl()
## biomart version
## 1 genes Ensembl Genes 116
## 2 mouse_strains Mouse strains 116
## 3 snps Ensembl Variation 116
## 4 regulation Ensembl Regulation 116
The useEnsembl() function can now be used to connect to the desired BioMart database. The biomart argument should be given a valid name from the output of listEnsembl(). In the next example we will select the main Ensembl mart, which provides access to gene annotation information.
ensembl <- useEnsembl(biomart = "genes")
If we print the current ensembl object, we can see that the ENSEMBL_MART_ENSEMBL database 1 this is how Ensembl name the database on their server has been selected, but that no dataset has been chosen.
ensembl
## Object of class 'Mart':
## Using the ENSEMBL_MART_ENSEMBL BioMart database
## No dataset selected.
BioMart databases can contain several datasets. For example, within the Ensembl genes mart every species is a different dataset. In the next step we look at which datasets are available in the selected BioMart by using the function listDatasets(). Note: here we use the function head() to display only the first 5 entries as the complete list has many entries.
datasets <- listDatasets(ensembl)
head(datasets)
## dataset description version
## 1 abrachyrhynchus_gene_ensembl Pink-footed goose genes (ASM259213v1) ASM259213v1
## 2 acalliptera_gene_ensembl Eastern happy genes (fAstCal1.3) fAstCal1.3
## 3 acarolinensis_gene_ensembl Green anole genes (AnoCar2.0v2) AnoCar2.0v2
## 4 acchrysaetos_gene_ensembl Golden eagle genes (bAquChr1.2) bAquChr1.2
## 5 acitrinellus_gene_ensembl Midas cichlid genes (Midas_v5) Midas_v5
## 6 amelanoleuca_gene_ensembl Giant panda genes (ASM200744v2) ASM200744v2
The listDatasets() function will return every available option, however this can be unwieldy when the list of results is long, involving much scrolling to find the entry you are interested in. biomaRt also provides the functions searchDatasets() which will try to find any entries matching a specific term or pattern. For example, if we want to find the details of any datasets in our ensembl mart that contain the term ‘hsapiens’ we could do the following:
searchDatasets(mart = ensembl, pattern = "hsapiens")
## dataset description version
## 80 hsapiens_gene_ensembl Human genes (GRCh38.p14) GRCh38.p14
To use a dataset we can update our Mart object using the function useDataset(). In the example below we choose to use the hsapiens dataset.
ensembl <- useDataset(dataset = "hsapiens_gene_ensembl", mart = ensembl)
As mentioned previously, if the dataset one wants to use is known in advance i.e. you’ve gone through this process before, we can select a both the database and dataset in one step:
ensembl <- useEnsembl(biomart = "genes", dataset = "hsapiens_gene_ensembl")
It is possible to query archived versions of Ensembl through biomaRt, so you can maintain consistent annotation throughout the duration of a project.
biomaRt provides the function listEnsemblArchives() to view the available Ensembl archives. This function takes no arguments, and produces a table containing the name and version number of the available archives, the date they were first released, and the URL where they can be accessed.
listEnsemblArchives()
## name date url version current_release
## 1 Ensembl GRCh37 Feb 2014 https://grch37.ensembl.org GRCh37
## 2 Ensembl 116 Jun 2026 https://jun2026.archive.ensembl.org 116 *
## 3 Ensembl 115 Sep 2025 https://sep2025.archive.ensembl.org 115
## 4 Ensembl 114 May 2025 https://may2025.archive.ensembl.org 114
## 5 Ensembl 113 Oct 2024 https://oct2024.archive.ensembl.org 113
## 6 Ensembl 112 May 2024 https://may2024.archive.ensembl.org 112
## 7 Ensembl 111 Jan 2024 https://jan2024.archive.ensembl.org 111
## 8 Ensembl 110 Jul 2023 https://jul2023.archive.ensembl.org 110
## 9 Ensembl 109 Feb 2023 https://feb2023.archive.ensembl.org 109
## 10 Ensembl 108 Oct 2022 https://oct2022.archive.ensembl.org 108
## 11 Ensembl 107 Jul 2022 https://jul2022.archive.ensembl.org 107
## 12 Ensembl 106 Apr 2022 https://apr2022.archive.ensembl.org 106
## 13 Ensembl 105 Dec 2021 https://dec2021.archive.ensembl.org 105
## 30 Ensembl 104 May 2021 https://may2021.archive.ensembl.org 104
## 31 Ensembl 103 Feb 2021 https://feb2021.archive.ensembl.org 103
## 32 Ensembl 102 Nov 2020 https://nov2020.archive.ensembl.org 102
## 33 Ensembl 101 Aug 2020 https://aug2020.archive.ensembl.org 101
## 34 Ensembl 100 Apr 2020 https://apr2020.archive.ensembl.org 100
## 35 Ensembl 99 Jan 2020 https://jan2020.archive.ensembl.org 99
## 36 Ensembl 98 Sep 2019 https://sep2019.archive.ensembl.org 98
## 37 Ensembl 97 Jul 2019 https://jul2019.archive.ensembl.org 97
## 38 Ensembl 96 Apr 2019 https://apr2019.archive.ensembl.org 96
## 39 Ensembl 95 Jan 2019 https://jan2019.archive.ensembl.org 95
## 40 Ensembl 94 Oct 2018 https://oct2018.archive.ensembl.org 94
## 41 Ensembl 93 Jul 2018 https://jul2018.archive.ensembl.org 93
## 42 Ensembl 92 Apr 2018 https://apr2018.archive.ensembl.org 92
## 43 Ensembl 91 Dec 2017 https://dec2017.archive.ensembl.org 91
## 44 Ensembl 90 Aug 2017 https://aug2017.archive.ensembl.org 90
## 45 Ensembl 89 May 2017 https://may2017.archive.ensembl.org 89
## 46 Ensembl 88 Mar 2017 https://mar2017.archive.ensembl.org 88
## 47 Ensembl 87 Dec 2016 https://dec2016.archive.ensembl.org 87
## 48 Ensembl 86 Oct 2016 https://oct2016.archive.ensembl.org 86
## 14 Ensembl 80 May 2015 https://may2015.archive.ensembl.org 80
## 15 Ensembl 77 Oct 2014 https://oct2014.archive.ensembl.org 77
## 16 Ensembl 75 Feb 2014 https://feb2014.archive.ensembl.org 75
## 17 Ensembl 54 May 2009 https://may2009.archive.ensembl.org 54
Alternatively, one can use the https://www.ensembl.org website to find an archived version. From the main page scroll down the bottom of the page, click on ‘view in Archive’ and select the archive you need.
You will notice that there is an archive URL even for the current release of Ensembl. It can be useful to use this if you wish to ensure that script you write now will return exactly the same results in the future. Using www.ensembl.org will always access the current release, and so the data retrieved may change over time as new releases come out.
Whichever method you use to find the URL of the archive you wish to query, copy the url and use that in the host argument as shown below to connect to the specified BioMart database. The example below shows how to query Ensembl 110.
listEnsembl(version = 110)
ensembl_110 <- useEnsembl(
biomart = "genes",
dataset = "hsapiens_gene_ensembl",
version = 110
)
Ensembl Genomes expands the effort to provide annotation from the vertebrate genomes provided by the main Ensembl project across taxonomic space, with separate BioMart interfaces for Protists, Plants, Metazoa and Fungi. 2 Note: Unfortunately there is no BioMart interface to the Ensembl Bacteria data. The number of bacterial genomes is in the tens of thousands and BioMart does not perform well when providing data on that scale.
You can use the functions listEnsemblGenomes() and useEnsemblGenomes() in similar fashion to the functions shown previously. For example first we can list the available Ensembl Genomes marts:
listEnsemblGenomes()
## biomart version
## 1 protists_mart Ensembl Protists Genes 63
## 2 protists_variations Ensembl Protists Variations 63
## 3 fungi_mart Ensembl Fungi Genes 63
## 4 fungi_variations Ensembl Fungi Variations 63
## 5 metazoa_mart Ensembl Metazoa Genes 63
## 6 metazoa_variations Ensembl Metazoa Variations 63
## 7 plants_mart Ensembl Plants Genes 63
## 8 plants_variations Ensembl Plants Variations 63
We can the select the Ensembl Plants database, and search for the dataset name for Arabidopsis.
ensembl_plants <- useEnsemblGenomes(biomart = "plants_mart")
searchDatasets(ensembl_plants, pattern = "Arabidopsis")
## dataset description version
## 7 ahalleri_eg_gene Arabidopsis halleri genes (Ahal2.2) Ahal2.2
## 11 alyrata_eg_gene Arabidopsis lyrata genes (v.1.0) v.1.0
## 42 athaliana_eg_gene Arabidopsis thaliana genes (TAIR10) TAIR10
We can then use this information to create our Mart object that will access the correct database and dataset.
ensembl_arabidopsis <- useEnsemblGenomes(
biomart = "plants_mart",
dataset = "athaliana_eg_gene"
)
Once we’ve selected a dataset to get data from, we need to create a query and send it to the Ensembl BioMart server. We do this using the getBM() function.
The getBM() function has three arguments that need to be introduced: filters, values and attributes.
Filters and values are used to define restrictions on the query. For example, if you want to restrict the output to all genes located on the human X chromosome then the filter chromosome_name can be used with value ‘X’. The listFilters() function shows you all available filters in the selected dataset.
filters <- listFilters(ensembl)
filters[1:5, ]
## name description
## 1 chromosome_name Chromosome/scaffold name
## 2 start Start
## 3 end End
## 4 band_start Band Start
## 5 band_end Band End
Attributes define the data we are interested in retrieving. For example, maybe we want to retrieve the gene symbols or chromosomal coordinates. The listAttributes() function displays all available attributes in the selected dataset.
attributes <- listAttributes(ensembl)
attributes[1:5, ]
## name description page
## 1 ensembl_gene_id Gene stable ID feature_page
## 2 ensembl_gene_id_version Gene stable ID version feature_page
## 3 ensembl_transcript_id Transcript stable ID feature_page
## 4 ensembl_transcript_id_version Transcript stable ID version feature_page
## 5 ensembl_peptide_id Protein stable ID feature_page
The getBM() function is the primary query function in biomaRt. It has four main arguments:
attributes: is a vector of attributes that one wants to retrieve (= the output of the query).filters: is a vector of filters that one wil use as input to the query.values: a vector of values for the filters. In case multple filters are in use, the values argument requires a list of values where each position in the list corresponds to the position of the filters in the filters argument (see examples below).mart: is an object of class Mart, which is created by the useEnsembl() function.Note: for some frequently used queries to Ensembl, wrapper functions are available: getGene() and getSequence(). These functions call the getBM() function with hard coded filter and attribute names.
Now that we selected a BioMart database and dataset, and know about attributes, filters, and the values for filters; we can build a biomaRt query. Let’s make an easy query for the following problem: We have a list of Affymetrix identifiers from the u133plus2 platform and we want to retrieve the corresponding EntrezGene identifiers using the Ensembl mappings.
The u133plus2 platform will be the filter for this query and as values for this filter we use our list of Affymetrix identifiers. As output (attributes) for the query we want to retrieve the EntrezGene and u133plus2 identifiers so we get a mapping of these two identifiers as a result. The exact names that we will have to use to specify the attributes and filters can be retrieved with the listAttributes() and listFilters() function respectively. Let’s now run the query:
affyids <- c("202763_at", "209310_s_at", "207500_at")
getBM(
attributes = c("affy_hg_u133_plus_2", "entrezgene_id"),
filters = "affy_hg_u133_plus_2",
values = affyids,
mart = ensembl
)
## affy_hg_u133_plus_2 entrezgene_id
## 1 207500_at 838
## 2 202763_at 836
## 3 209310_s_at 837
The functions listAttributes() and listFilters() will return every available option for their respective types, which can produce a very long output where it is hard to find the value you are interested in. biomaRt also provides the functions searchAttributes() and searchFilters() which will try to find any entries matching a specific term or pattern, in a similar fashion to searchDatasets() seen previously. You can use these functions to find available attributes and filters that you may be interested in. The example below returns the details for all attributes that contain the pattern ‘hgnc’.
searchAttributes(mart = ensembl, pattern = "hgnc")
## name description page
## 63 hgnc_id HGNC ID feature_page
## 64 hgnc_symbol HGNC symbol feature_page
## 95 hgnc_trans_name Transcript name ID feature_page
For advanced use, note that the pattern argument takes a regular expression. This means you can create more complex queries if required. Imagine, for example, that we have the string ENST00000577249.1, which we know is an Ensembl ID of some kind, but we aren’t sure what the appropriate filter term is. The example shown next uses a pattern that will find all filters that contain the terms ‘ensembl’ and ‘id’. This allows us to reduced the list of filters to only those that might be appropriate for our example.
searchFilters(mart = ensembl, pattern = "ensembl.*id")
## name description
## 54 ensembl_gene_id Gene stable ID(s) [e.g. ENSG00000000003]
## 55 ensembl_gene_id_version Gene stable ID(s) with version [e.g. ENSG00000000003.18]
## 56 ensembl_transcript_id Transcript stable ID(s) [e.g. ENST00000000233]
## 57 ensembl_transcript_id_version Transcript stable ID(s) with version [e.g. ENST00000000233.10]
## 58 ensembl_peptide_id Protein stable ID(s) [e.g. ENSP00000000233]
## 59 ensembl_peptide_id_version Protein stable ID(s) with version [e.g. ENSP00000000233.5]
## 60 ensembl_exon_id Exon ID(s) [e.g. ENSE00000000001]
From this we can compare ENST00000577249.1 with the examples given in the description column, and see it is a Transcript ID with version. Thus the appropriate filter value to use with it is ensembl_transcript_id_version.
Many filters have a predefined list of values that are known to be in the dataset they are associated with. A common example would be the names of chromosomes when searching a dataset at Ensembl. In this online interface to BioMart these available options are displayed as a list as shown in Figure 1.
Figure 1: The options available to the Chromosome/Scaffold field are limited to a pretermined list based on the values in this dataset
You can list this in an R session with the function listFilterOptions(), passing it a Mart object and the name of the filter. For example, to list the possible chromosome names you could run the following:
listFilterOptions(mart = ensembl, filter = "chromosome_name")
It is also possible to search the list of available values via searchFilterOptions(). In the two examples below, the first returns all chromosome names starting with “GL”, while the second will find any phenotype descriptions that contain the string “Crohn”.
searchFilterOptions(mart = ensembl, filter = "chromosome_name", pattern = "^GL")
## [1] "GL000008.2" "GL000009.2" "GL000194.1" "GL000195.1" "GL000205.2" "GL000213.1" "GL000214.1"
## [8] "GL000216.2" "GL000218.1" "GL000219.1" "GL000220.1" "GL000221.1" "GL000224.1" "GL000225.1"
searchFilterOptions(
mart = ensembl,
filter = "phenotype_description",
pattern = "Crohn"
)
## [1] "INFLAMMATORY BOWEL DISEASE CROHN DISEASE 1" "INFLAMMATORY BOWEL DISEASE CROHN DISEASE 10"
## [3] "INFLAMMATORY BOWEL DISEASE CROHN DISEASE 19" "INFLAMMATORY BOWEL DISEASE CROHN DISEASE 30"
Boolean filters need a value TRUE or FALSE in biomaRt. Setting the value TRUE will include all information that fulfil the filter requirement. Setting FALSE will exclude the information that fulfills the filter requirement and will return all values that don’t fulfil the filter. For most of the filters, their name indicates if the type is a boolean or not and they will usually start with “with”. However this is not a rule and to make sure you got the type right you can use the function filterType() to investigate the type of the filter you want to use.
filterType("with_affy_hg_u133_plus_2", ensembl)
## [1] "boolean_list"
For large BioMart databases such as Ensembl, the number of attributes displayed by the listAttributes() function can be very large.
In BioMart databases, attributes are put together in pages, such as sequences, features, homologs for Ensembl.
An overview of the attributes pages present in the respective BioMart dataset can be obtained with the attributePages() function.
pages <- attributePages(ensembl)
pages
## [1] "feature_page" "structure" "homologs" "snp" "snp_somatic" "sequences"
To show us a smaller list of attributes which belong to a specific page, we can now specify this in the listAttributes() function.3 The set of attributes is still quite long, so we use head() to show only the first few items here.
head(listAttributes(ensembl, page = "feature_page"))
## name description page
## 1 ensembl_gene_id Gene stable ID feature_page
## 2 ensembl_gene_id_version Gene stable ID version feature_page
## 3 ensembl_transcript_id Transcript stable ID feature_page
## 4 ensembl_transcript_id_version Transcript stable ID version feature_page
## 5 ensembl_peptide_id Protein stable ID feature_page
## 6 ensembl_peptide_id_version Protein stable ID version feature_page
We now get a short list of attributes related to the region where the genes are located.
select()In order to provide a more consistent interface to all annotations in Bioconductor the select(), columns(), keytypes() and keys() have been implemented to wrap some of the existing functionality above. These methods can be called in the same manner that they are used in other parts of the project except that instead of taking a AnnotationDb derived class they take instead a Mart derived class as their 1st argument. Otherwise usage should be essentially the same. You still use columns() to discover things that can be extracted from a Mart, and keytypes() to discover which things can be used as keys with select().
mart <- useEnsembl(dataset = "hsapiens_gene_ensembl", biomart = "ensembl")
head(keytypes(mart), n = 3)
## [1] "affy_hc_g110" "affy_hg_focus" "affy_hg_u133_plus_2"
head(columns(mart), n = 3)
## [1] "3_utr_end" "3_utr_end" "3_utr_start"
And you still can use keys() to extract potential keys, for a
particular key type.
k <- keys(mart, keytype = "chromosome_name")
head(k, n = 3)
## [1] "1" "2" "3"
When using keys(), you can even take advantage of the extra
arguments that are available for others keys methods.
k <- keys(mart, keytype = "chromosome_name", pattern = "LRG")
head(k, n = 3)
## character(0)
Unfortunately the keys() method will not work with all key types because they are not all supported.
But you can still use select() here to extract columns of data that match a particular set of keys (this is basically a wrapper for getBM()).
affy <- c("202763_at", "209310_s_at", "207500_at")
select(
mart,
keys = affy,
columns = c("affy_hg_u133_plus_2", "entrezgene_id"),
keytype = "affy_hg_u133_plus_2"
)
## affy_hg_u133_plus_2 entrezgene_id
## 1 207500_at 838
## 2 202763_at 836
## 3 209310_s_at 837
So why would we want to do this when we already have functions like getBM()? For two reasons: 1) for people who are familiar
with select and it’s helper methods, they can now proceed to use biomaRt making the same kinds of calls that are already familiar to them and 2) because the select method is implemented in many places elsewhere, the fact that these methods are shared allows for more convenient programmatic access of all these resources. An example of a package that takes advantage of this is the OrganismDbi package. Where several packages can be accessed as if they were one resource.
To save time and computing resources biomaRt will attempt to identify when you are re-running a query you have executed before. Each time a new query is run, the results will be saved to a cache on your computer. If a query is identified as having been run previously, rather than submitting the query to the server, the results will be loaded from the cache.
You can get some information on the size and location of the cache using the function biomartCacheInfo():
biomartCacheInfo()
## biomaRt cache
## - Location: /Users/biocbuild/Library/Caches/org.R-project.R/R/biomaRt
## - No. of files: 332
## - Total size: 16.6 Mb
The cache can be deleted using the command biomartCacheClear(). This will remove all cached files.
The default location for the cache is specific to your computer and operating system. If you want to use a specific location you can set this via the BIOMART_CACHE environment variable. You can either set this outside of R, or within R via a call to Sys.setenv(BIOMART_CACHE = "</where/i/store/my/cache>"). The code below gives an example where we change the location to a temporary file4 This would not be a sensible choice on your machine, but is convenient on the Bioconductor server. and then confirm that the location has changed.
Sys.setenv(BIOMART_CACHE = tempdir())
biomartCacheInfo()
## biomaRt cache
## - Location: /tmp/RtmpYuYKAh
## - No. of files: 0
## - Total size: 0 bytes
This section describes a set of biomaRt helper functions that can be used to export FASTA format sequences, retrieve values for certain filters and exploring the available filters and attributes in a more systematic manner.
The data.frames obtained by the getSequence() function can be exported to FASTA files using the exportFASTA() function. One has to specify the data.frame to export and the file name using the file argument.
In the sections below a variety of example queries are described. Every example is written as a task, and we have to come up with a biomaRt solution to the problem.
We have a list of Affymetrix hgu133plus2 identifiers and we would like to retrieve the HUGO gene symbols, chromosome names, start and end positions and the bands of the corresponding genes. The listAttributes() and the listFilters() functions give us an overview of the available attributes and filters and we look in those lists to find the corresponding attribute and filter names we need. For this query we’ll need the following attributes: hgnc_symbol, chromsome_name, start_position, end_position, band and affy_hg_u133_plus_2 (as we want these in the output to provide a mapping with our original Affymetrix input identifiers. There is one filter in this query which is the affy_hg_u133_plus_2 filter as we use a list of Affymetrix identifiers as input. Putting this all together in the getBM() and performing the query gives:
affyids <- c("202763_at", "209310_s_at", "207500_at")
getBM(
attributes = c(
"affy_hg_u133_plus_2",
"hgnc_symbol",
"chromosome_name",
"start_position",
"end_position",
"band"
),
filters = "affy_hg_u133_plus_2",
values = affyids,
mart = ensembl
)
## affy_hg_u133_plus_2 hgnc_symbol chromosome_name start_position end_position band
## 1 207500_at CASP5 11 104991932 105023169 q22.3
## 2 202763_at CASP3 4 184627695 184650418 q35.1
## 3 209310_s_at CASP4 11 104942866 104969366 q22.3
In this task we start out with a list of EntrezGene identiers and we want to retrieve GO identifiers related to biological processes that are associated with these entrezgene identifiers. Again we look at the output of listAttributes() and listFilters() to find the filter and attributes we need. Then we construct the following query:
entrez <- c("673", "837")
goids <- getBM(
attributes = c("entrezgene_id", "go_id"),
filters = "entrezgene_id",
values = entrez,
mart = ensembl
)
head(goids)
## entrezgene_id go_id
## 1 673 GO:0005524
## 2 673 GO:0007165
## 3 673 GO:0006468
## 4 673 GO:0004672
## 5 673 GO:0000166
## 6 673 GO:0016740
The GO terms we are interested in are: GO:0051330, GO:0000080, GO:0000114, GO:0000082. The key to performing this query is to understand that the getBM() function enables you to use more than one filter at the same time. In order to do this, the filter argument should be a vector with the filter names. The values should be a list, where the first element of the list corresponds to the first filter and the second list element to the second filter and so on. The elements of this list are vectors containing the possible values for the corresponding filters.
go <- c("GO:0051330", "GO:0000080", "GO:0000114", "GO:0000082")
chrom <- c(17, 20, "Y")
getBM(
attributes = "hgnc_symbol",
filters = c("go", "chromosome_name"),
values = list(go, chrom),
mart = ensembl
)
## hgnc_symbol
## 1 RPS6KB1
## 2 CDK3
In this example we want to annotate the following two RefSeq identifiers: NM_005359 and NM_000546 with INTERPRO protein domain identifiers and a description of the protein domains.
refseqids <- c("NM_005359", "NM_000546")
ipro <- getBM(
attributes = c("refseq_mrna", "interpro", "interpro_description"),
filters = "refseq_mrna",
values = refseqids,
mart = ensembl
)
ipro
## refseq_mrna interpro interpro_description
## 1 NM_000546 IPR008967 p53-like transcription factor, DNA-binding domain superfamily
## 2 NM_000546 IPR036674 p53-like tetramerisation domain superfamily
## 3 NM_000546 IPR012346 p53/RUNT-type transcription factor, DNA-binding domain superfamily
## 4 NM_000546 IPR002117 p53 tumour suppressor family
## 5 NM_000546 IPR011615 p53, DNA-binding domain
## 6 NM_000546 IPR057064 p53, central conserved site
## 7 NM_000546 IPR010991 p53, tetramerisation domain
## 8 NM_000546 IPR040926 Cellular tumor antigen p53, transactivation domain 2
## 9 NM_000546 IPR013872 p53, transactivation domain
## 10 NM_005359 IPR003619 MAD homology 1, Dwarfin-type
## 11 NM_005359 IPR008984 SMAD/FHA domain superfamily
## 12 NM_005359 IPR017855 SMAD-like domain superfamily
## 13 NM_005359 IPR001132 SMAD domain, Dwarfin-type
## 14 NM_005359 IPR013019 MAD homology, MH1
## 15 NM_005359 IPR036578 SMAD MH1 domain superfamily
## 16 NM_005359 IPR013790 Dwarfin
In this example we will again use multiple filters: chromosome_name, start, and end as we filter on these three conditions. Note that when a chromosome name, a start position and an end position are jointly used as filters, the BioMart webservice interprets this as return everything from the given chromosome between the given start and end positions.
getBM(
attributes = c("affy_hg_u133_plus_2", "ensembl_gene_id"),
filters = c("chromosome_name", "start", "end"),
values = list(16, 1100000, 1250000),
mart = ensembl
)
## affy_hg_u133_plus_2 ensembl_gene_id
## 1 ENSG00000292423
## 2 ENSG00000260702
## 3 ENSG00000260532
## 4 215502_at ENSG00000260532
## 5 ENSG00000292400
## 6 ENSG00000292401
## 7 ENSG00000273551
## 8 205845_at ENSG00000196557
## 9 ENSG00000196557
## 10 ENSG00000260403
## 11 ENSG00000259910
## 12 ENSG00000261294
## 13 220339_s_at ENSG00000116176
## 14 210084_x_at ENSG00000197253
## 15 217023_x_at ENSG00000197253
## 16 216474_x_at ENSG00000197253
## 17 205683_x_at ENSG00000197253
## 18 207134_x_at ENSG00000197253
## 19 215382_x_at ENSG00000197253
## 20 ENSG00000292385
## 21 210084_x_at ENSG00000172236
## 22 217023_x_at ENSG00000172236
## 23 216474_x_at ENSG00000172236
## 24 205683_x_at ENSG00000172236
## 25 207134_x_at ENSG00000172236
## 26 215382_x_at ENSG00000172236
The GO identifier for MAP kinase activity is GO:0004707. In our query we will use go_id as our filter, and entrezgene_id and hgnc_symbol as attributes. Here’s the query:
getBM(
attributes = c("entrezgene_id", "hgnc_symbol"),
filters = "go",
values = "GO:0004707",
mart = ensembl
)
## entrezgene_id hgnc_symbol
## 1 1022 CDK7
## 2 225689 MAPK15
## 3 6300 MAPK12
## 4 5596 MAPK4
## 5 5600 MAPK11
## 6 5595 MAPK3
## 7 6885 MAP3K7
## 8 1432 MAPK14
## 9 5597 MAPK6
## 10 5127 CDK16
## 11 5594 MAPK1
## 12 5891 MOK
## 13 2932 GSK3B
## 14 8621 CDK13
## 15 5599 MAPK8
## 16 5601 MAPK9
## 17 5603 MAPK13
## 18 5602 MAPK10
## 19 51701 NLK
## 20 5598 MAPK7
All sequence related queries to Ensembl are available through the getSequence() wrapper function. getBM() can also be used directly to retrieve sequences but this can get complicated so using getSequence() is provided as a general purpose function suitable for most situations.
Sequences can be retrieved using the getSequence() function either starting from chromosomal coordinates or identifiers.
The chromosome name can be specified using the chromosome argument. The start and end arguments are used to specify start and end positions on the chromosome.
The type of sequence returned can be specified by the seqType argument which takes the following values:
This task requires us to retrieve 100bp upstream promoter sequences from a set of EntrezGene identifiers. The type argument in getSequence() can be thought of as the filter in this query and uses the same input names given by listFilters(). In our query we use entrezgene_id for the type argument. Next we have to specify which type of sequences we want to retrieve, here we are interested in the sequences of the promoter region, starting right next to the coding start of the gene. Setting the seqType to coding_gene_flank will give us what we need. The upstream argument is used to specify how many bp of upstream sequence we want to retrieve, here we’ll retrieve a rather short sequence of 100bp. Putting this all together in getSequence() gives:
entrez <- c("673", "7157", "837")
getSequence(
id = entrez,
type = "entrezgene_id",
seqType = "coding_gene_flank",
upstream = 100,
mart = ensembl
)
## coding_gene_flank entrezgene_id
## 1 NA 7157
## 2 NA 673
## 3 NA 837
One further thing to note is that, although we are searching for genes based on their NCBI Gene IDs, Ensembl BioMart doesn’t allow some ID types (including NCBI IDs) to be returned directly. To try and accommodate this biomaRt attempts to map the query IDs to Ensembl Gene IDs internally before finding the sequence information. If no such mapping exists (or at least isn’t found in Ensembl) then no sequence will be returned for the affected IDs.
As described in the previous task getSequence() can also use chromosomal coordinates to retrieve sequences of all genes that lie in the given region. We also have to specify which type of identifier we want to retrieve together with the sequences. Here we choose the NCBI Gene ID5 These were historically called “Entrezgene IDs”, hence the name given to the type argument.
utr5 <- getSequence(
chromosome = 3,
start = 185514033,
end = 185535839,
type = "entrezgene_id",
seqType = "5utr",
mart = ensembl
)
utr5
## 5utr
## 1 AGTCAGTCCCTAGGGAACTTCCTGTTGTCACCACACCTCTGAGTCGTCTGAGCTCACTGTGAGCAAAATCCCACAGTGGAAACTCTTAAGCCTCTGCGAAGTAAATCATTCTTGTGAATGTGACACACGATCTCTCCAGTTTCCAT
## 2 CCCTAGGGAACTTCCTGTTGTCACCACACCTCTGAGTCGTCTGAGCTCACTGTGAGCAAAATCCCACAGTGGAAACTCTTAAGCCTCTGCGAAGTAAATCATTCTTGTGAATGTGACACACGATCTCTCCAGTTTCCAT
## 3 Sequence unavailable
## 4 ATTCTTGTGAATGTGACACACGATCTCTCCAGTTTCCAT
## 5 Sequence unavailable
## 6 ACCACACCTCTGAGTCGTCTGAGCTCACTGTGAGCAAAATCCCACAGTGGAAACTCTTAAGCCTCTGCGAAGTAAATCATTCTTGTGAATGTGACACACGATCTCTCCAGTTTCCAT
## 7 TCCCTAGGGAACTTCCTGTTGTCACCACACCTCTGAGTCGTCTGAGCTCACTGTGAGCAAAATCCCACAGTGGAAACTCTTAAGCCTCTGCGAAGTAAATCATTCTTGTGAATGTGACACACGATCTCTCCAGTTTCCAT
## entrezgene_id
## 1 200879
## 2 200879
## 3 NA
## 4 200879
## 5 200879
## 6 200879
## 7 200879
In this task the type argument specifies which type of identifiers we are using.
To get an overview of other valid identifier types we refer to the listFilters() function.
protein <- getSequence(
id = c(27112, 653067),
type = "entrezgene_id",
seqType = "peptide",
mart = ensembl
)
protein
## peptide
## 1 MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADHLWLCAGARPRARELSSAMRPPWGAGRERQPVPPRAVLPLPPPPPGEPSAPPGTCGPRYSNLTKAAPAAGSRPVCGGVPEPTGLDAACTKLQSLQRLFEPTTPAPPLRPPDSLSRAPAEFPSAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPDSLDCSLDTLMGDLLAVVASPGSGAWEACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFSVTQQECQRWVPCKQYCLEVQTRCPFILPDNEEMVYGGLPGFICTGLLDTSPKRLETKCCDVQWVSCEAKKKKFKESEAPKTHQQQFHHSYFHHYHQQYHHYHPHHDPPGRVSNKPALLPVSGGSRLSPSRIRLCVLVLMLLHTVVSFSSNQGGGGLGLETLPALEEGLTREE*
## 2 MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADHLWLCAGARPRARELSSAMRPPWGAGRERQPVPPRAVLPLPPPPPGEPSAPPGTCGPRYSNLTKAAPAAGSRPVCGGVPEPTGLDAACTKLQSLQRLFEPTTPAPPLRPPDSLSRAPAEFPSAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPDSLDCSLDTLMGDLLAVVASPGSGAWEACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKKLCAH*
## 3 MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADHLWLCAGARPRARELSSAMRPPWGAGRERQPVPPRAVLPLPPPPPGEPSAPPGTCGPRYSNLTKAAPAAGSRPVCGGVPEPTGLDAACTKLQSLQRLFEPTTPAPPLRPPDSLSRAPAEFPSAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPDSLDCSLDTLMGDLLAVVASPGSGAWEACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKRLELNVLGLAGAGGRPKMGGRIFGNQTLTLWLLPVGERTSTPGGGAHHTLDLM*
## 4 MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV*
## 5 MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAAFPQ*
## 6 Sequence unavailable
## 7 MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQVLGREMRDMEGDLQELHQSNTGDKSGFGFRRQGEDNT*
## 8 MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAEQPQV*
## entrezgene_id
## 1 27112
## 2 27112
## 3 27112
## 4 653067
## 5 653067
## 6 653067
## 7 653067
## 8 653067
For this example we’ll first have to connect to a different BioMart database, namely snp.
snpmart <- useEnsembl(biomart = "snp", dataset = "hsapiens_snp")
The listAttributes() and listFilters() functions give us an overview of the available attributes and filters.
From these we need: refsnp_id, allele, chrom_start and chrom_strand as attributes; and as filters we’ll use: chrom_start, chrom_end and chr_name.
6 Note that when a chromosome name, a start position and an end position are jointly used as filters,
the BioMart webservice interprets this as return everything from the given chromosome between the given start and end positions. Putting our selected attributes and filters into getBM() gives:
getBM(
attributes = c("refsnp_id", "allele", "chrom_start", "chrom_strand"),
filters = c("chr_name", "start", "end"),
values = list(8, 148350, 148400),
mart = snpmart
)
## refsnp_id allele chrom_start chrom_strand
## 1 rs1450830176 G/C 148350 1
## 2 rs1360310185 C/A/T 148352 1
## 3 rs1434776028 A/T 148353 1
## 4 rs1800818835 A/T 148355 1
## 5 rs1413161474 C/T 148356 1
## 6 rs1800818940 T/G 148358 1
## 7 rs1800818966 C/T 148362 1
## 8 rs1800818982 C/T 148363 1
## 9 rs1410590268 A/G 148365 1
## 10 rs1193735780 T/A/C 148368 1
## 11 rs1800819063 T/A/C 148370 1
## 12 rs1409139861 C/T 148371 1
## 13 rs868546642 A/G 148372 1
## 14 rs547420070 A/C/G 148373 1
## 15 rs1236874674 C/T 148375 1
## 16 rs1207902742 C/T 148376 1
## 17 rs1437239557 T/C 148377 1
## 18 rs1160135941 T/C/G 148379 1
## 19 rs1229249227 A/G/T 148380 1
## 20 rs1584865972 C/G 148381 1
## 21 rs1800819310 T/G 148382 1
## 22 rs1800819329 T/C 148384 1
## 23 rs1328678285 C/G 148390 1
## 24 rs77274555 G/A/C/T 148391 1
## 25 rs1800819423 T/C 148392 1
## 26 rs567299969 T/A/C 148394 1
## 27 rs1457776094 A/C/G 148395 1
## 28 rs1800819520 T/C 148396 1
This is a multi-step process involving several biomaRt functions. First we’ll query the human gene dataset with the TP53 gene symbol, and return the chromosomal location. Note we also retrieve the Ensembl Gene ID, as this will be required in the next step.
human <- useEnsembl("ensembl", dataset = "hsapiens_gene_ensembl")
BRCA2_human <- getBM(
mart = human,
filters = "hgnc_symbol",
value = "BRCA2",
attributes = c("ensembl_gene_id", "chromosome_name", "start_position")
)
BRCA2_human
## ensembl_gene_id chromosome_name start_position
## 1 ENSG00000139618 13 32315086
Next we can use the getHomologs() function to find homologous genes between two species. For this we need to provide the ensembl IDs for the genes we’re interest in, which is why we included this in the output retrieved before. getHomologs() can actually take the English names for the organisms you’re interested in, and will
attempt to find the correct BioMart dataset 7 We get a warning for the term ‘mouse’ as there are multiple strains in BioMart. In this case biomaRt selects the reference strain. Our returned table contains the paired Ensembl IDs between the two organisms.
homologs <- getHomologs(
ensembl_gene_ids = BRCA2_human$ensembl_gene_id,
species_from = "human",
species_to = "mouse"
)
homologs
## ensembl_gene_id mmusculus_homolog_ensembl_gene
## 1 ENSG00000139618 ENSMUSG00000041147
Finally we can use the mouse Ensembl gene IDs found by getHomologs() to query the mouse gene dataset and get the details we require.
mouse <- useEnsembl("ensembl", dataset = "mmusculus_gene_ensembl")
BRCA2_mouse <- getBM(
mart = mouse,
filters = "ensembl_gene_id",
values = homologs$mmusculus_homolog_ensembl_gene,
attributes = c("refseq_mrna", "chromosome_name", "start_position")
)
BRCA2_mouse
## refseq_mrna chromosome_name start_position
## 1 5 150446057
## 2 NM_009765 5 150446057
## 3 NM_001081001 5 150446057
It is not uncommon to encounter connection problems when trying to access online resources such as the Ensembl BioMart. In this section we list error messages that have been reported by users, along with suggested code to fix the problem. If a suggested solution doesn’t work, or you have a new error not listed here, please reported it on the Bioconductor Support Site.
If you are using biomaRt directly make sure you are using useEnsembl() to create the Mart object, rather than useMart(). useEnsembl() is aware of some specific connection details required to connect to Ensembl, and using it may fix any connection problems without requiring you to do anything further.
If you are unable to modify the biomaRt code (for example if you are using another package that calls biomaRt as part of one if its functions) it’s still possible to modify the connection settings for your R session. Below are some reported error messages and code that has been known to resolve them. You will need to execute this code only once in an R session. The settings will then be saved to the biomaRt cache and will be used from then on when you try to connect to the Ensembl BioMart.
sessionInfo()
## R version 4.6.1 Patched (2026-06-24 r90190)
## Platform: x86_64-apple-darwin20
## Running under: macOS Ventura 13.7.8
##
## Matrix products: default
## BLAS: /Library/Frameworks/R.framework/Versions/4.6-x86_64/Resources/lib/libRblas.0.dylib
## LAPACK: /Library/Frameworks/R.framework/Versions/4.6-x86_64/Resources/lib/libRlapack.dylib; LAPACK version 3.12.1
##
## locale:
## [1] C/en_US.UTF-8/en_US.UTF-8/C/en_US.UTF-8/en_US.UTF-8
##
## time zone: America/New_York
## tzcode source: internal
##
## attached base packages:
## [1] stats graphics grDevices utils datasets methods base
##
## other attached packages:
## [1] biomaRt_2.69.3 BiocStyle_2.41.0
##
## loaded via a namespace (and not attached):
## [1] sass_0.4.10 generics_0.1.4 xml2_1.6.0 RSQLite_3.53.3
## [5] stringi_1.8.9 hms_1.1.4 digest_0.6.39 magrittr_2.0.5
## [9] evaluate_1.0.5 bookdown_0.48 fastmap_1.2.0 blob_1.3.0
## [13] jsonlite_2.0.0 progress_1.2.3 AnnotationDbi_1.75.2 DBI_1.3.0
## [17] BiocManager_1.30.27 httr_1.4.9 purrr_1.2.2 Biostrings_2.81.9
## [21] httr2_1.3.0 jquerylib_0.1.4 cli_3.6.6 rlang_1.3.0
## [25] crayon_1.5.3 XVector_0.53.0 dbplyr_2.6.0 Biobase_2.73.2
## [29] bit64_4.8.6 withr_3.0.3 cachem_1.1.0 yaml_2.3.12
## [33] BiocBaseUtils_1.15.1 otel_0.2.0 tools_4.6.1 memoise_2.0.1
## [37] dplyr_1.2.1 filelock_1.0.3 BiocGenerics_0.59.12 curl_8.0.0
## [41] png_0.1-9 vctrs_0.7.3 R6_2.6.1 stats4_4.6.1
## [45] BiocFileCache_3.3.0 lifecycle_1.0.5 Seqinfo_1.3.2 KEGGREST_1.53.6
## [49] stringr_1.6.0 S4Vectors_0.51.10 IRanges_2.47.5 bit_4.6.0
## [53] pkgconfig_2.0.3 pillar_1.11.1 bslib_0.12.0 glue_1.8.1
## [57] xfun_0.61 tibble_3.3.1 tidyselect_1.2.1 knitr_1.52
## [61] htmltools_0.5.9 rmarkdown_2.32 compiler_4.6.1 prettyunits_1.2.0